4JVA: RIIbeta(108-402)

Crystal Structure of RIIbeta(108-402) bound to HE33, a N6 di-propyl substituted cAMP analog. Determined by X-ray diffraction at 2.5 Å resolution. Released 18 Sept 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,143
Mol. weight: 34.98 kDa
Ligands: 1OR
Released: 18 Sept 2013

Explore 4JVA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JVA contains 14 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	137-147	11
α-helix	151-153	3
α-helix	158-167	10
β-strand	169-173	5	1
β-strand	178-180	3	2
β-strand	188-194	7	1
β-strand	196-203	8	2
β-strand	206-214	9	2
β-strand	218-219	2	1
α-helix	222-226	5
β-strand	233-236	4	2
β-strand	240-246	7	1
α-helix	247-250	4
α-helix	251-255	5
α-helix	256-269	14
α-helix	273-275	3
α-helix	282-284	3
α-helix	287-289	3
β-strand	291-295	5	3
β-strand	300-302	3	3
β-strand	310-311	2	4
β-strand	312-313	2	5
β-strand	314-323	10	3
β-strand	337-342	6	3
β-strand	347-348	2	5
α-helix	351-354	4
β-strand	362-373	12	3
β-strand	374-375	2	4
α-helix	376-382	7
α-helix	384-386	3
α-helix	387-393	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-beta regulatory subunit	A	protein	305	Rattus norvegicus	P12369 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JVA_1 cAMP-dependent protein kinase type II-beta regulatory subunit (chains A)
SVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEK
LVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRA
ATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIG
TKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLRGQYFGEL
ALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDI
VEPTA

Ligands and cofactors

ID	Name	Formula	Copies
1OR	(2R,4aR,6R,7R,7aS)-6-[6-(dipropylamino)-9H-purin-9-yl]tetrahydro-4H-furo[3,2-d]…	C16 H24 N5 O6 P	2

Primary citation

Implementing Fluorescence Anisotropy Screening and Crystallographic Analysis to Define PKA Isoform-Selective Activation by cAMP Analogs. Brown, S.H., Cheng, C.Y., Saldanha, S.A. et al. ACS Chem Biol (2013) 8:2164-2172. DOI 10.1021/cb400247t · PubMed

Other PDB entries of the same protein (UniProt P12369 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IDB 1.62 Å, Crystal structure of (108-268)RIIb:C holoenzyme of cAMP-dependent protein kinase
1CX4 2.45 Å, Crystal structure of a deletion mutant of the type II beta regulatory subunit of…
3IDC 2.7 Å, Crystal structure of (102-265)RIIb:C holoenzyme of cAMP-dependent protein kinase
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma
6WJF 7.5 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 4JVA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.