1CX8: Ectodomain of human transferrin receptor

Crystal structure of the ectodomain of human transferrin receptor. Determined by X-ray diffraction at 3.2 Å resolution. Released 9 Sept 1999.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 8
Atoms: 40,808
Mol. weight: 581.9 kDa
Ligands: NAG, SM
Released: 9 Sept 1999

Explore 1CX8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CX8 contains 236 α-helices and 260 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	150-152	3
α-helix	160-175	16
β-strand	183-193	11	1
α-helix	197-198	2
β-strand	199-203	5	2
β-strand	214	1	2
β-strand	220	1	3
β-strand	226-230	5	2
β-strand	232-234	3	4
β-strand	254-258	5	4
α-helix	264-273	10
β-strand	279-282	4	4
β-strand	297	1	5
β-strand	299	1	3
β-strand	334-337	4	4
α-helix	339-347	9
β-strand	349	1	6
β-strand	366	1	4
β-strand	367	1	6
β-strand	372-377	6	2
β-strand	379-389	11	1
β-strand	392-393	2	7
β-strand	398	1	8
β-strand	402-406	5	7
α-helix	416-421	6
α-helix	422-438	17
β-strand	446	1	8
β-strand	448-451	4	7
β-strand	452	1	1
α-helix	456-458	3
α-helix	461-467	7
α-helix	468-470	3
α-helix	474-477	4
β-strand	478-483	6	7
β-strand	488	1	9
β-strand	495-498	4	10
α-helix	500-502	3
α-helix	503-510	8
α-helix	513	1
β-strand	514	1	11
α-helix	515	1
β-strand	521	1	11
β-strand	533	1	10
α-helix	534-536	3
α-helix	541-546	6
β-strand	552	1	7
β-strand	553-556	4	10
β-strand	557	1	9
β-strand	568	1	5
α-helix	573-577	5
α-helix	583-603	21
α-helix	613-626	14
α-helix	629-634	6
α-helix	640-662	23
α-helix	668-681	14
α-helix	683-685	3
β-strand	686	1	12
β-strand	699	1	12
α-helix	709-716	8
α-helix	717-719	3
α-helix	728-748	21

Chain B: 30 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	150-152	3
α-helix	160-175	16
β-strand	183-193	11	13
α-helix	197-198	2
β-strand	199-203	5	14
β-strand	214	1	14
β-strand	220	1	15
β-strand	226-230	5	14
β-strand	232-234	3	16
β-strand	254-258	5	16
α-helix	264-273	10
β-strand	279-282	4	16
β-strand	297	1	17
β-strand	299	1	15
β-strand	334-337	4	16
α-helix	339-347	9
β-strand	349	1	18
β-strand	366	1	16
β-strand	367	1	18
β-strand	372-377	6	14
β-strand	379-389	11	13
β-strand	392-393	2	19
β-strand	398-406	9	19
α-helix	416-421	6
α-helix	422-438	17
β-strand	446-451	6	19
β-strand	452	1	13
α-helix	456-458	3
α-helix	461-467	7
α-helix	468-470	3
α-helix	474-477	4
β-strand	478-483	6	19
β-strand	488	1	20
β-strand	495-498	4	21
α-helix	500-502	3
α-helix	503-510	8
α-helix	513	1
β-strand	514	1	22
α-helix	515	1
β-strand	521	1	22
β-strand	527-529	3	23
β-strand	532-533	2	21
α-helix	534-536	3
α-helix	541-546	6
β-strand	552	1	19
β-strand	553-556	4	21
β-strand	557	1	20
α-helix	565-567	3
β-strand	568	1	17
α-helix	573-577	5
α-helix	583-603	21
α-helix	613-626	14
α-helix	629-634	6
α-helix	640-662	23
α-helix	668-681	14
α-helix	683-685	3
β-strand	686	1	24
β-strand	699	1	24
α-helix	709-716	8
α-helix	717-721	5
α-helix	728-748	21

Chains C and F: 30 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	150-152	3
α-helix	160-175	16
β-strand	183-193	11	25
α-helix	197-198	2
β-strand	199-203	5	26
β-strand	214	1	26
β-strand	220	1	27
β-strand	226-230	5	26
β-strand	232-234	3	28
β-strand	254-258	5	28
α-helix	264-273	10
β-strand	279-282	4	28
β-strand	297	1	29
β-strand	299	1	27
β-strand	334-337	4	28
α-helix	339-347	9
β-strand	349	1	30
β-strand	366	1	28
β-strand	367	1	30
β-strand	372-377	6	26
β-strand	379-389	11	25
β-strand	392-393	2	31
β-strand	398-406	9	31
α-helix	416-421	6
α-helix	422-438	17
β-strand	446-451	6	31
β-strand	452	1	25
α-helix	456-458	3
α-helix	461-467	7
α-helix	468-470	3
α-helix	474-477	4
β-strand	478-483	6	31
β-strand	488	1	32
β-strand	495-498	4	23
α-helix	500-502	3
α-helix	503-510	8
α-helix	513	1
β-strand	514	1	33
α-helix	515	1
β-strand	521	1	33
β-strand	527-529	3	21
β-strand	532-533	2	23
α-helix	534-536	3
α-helix	541-546	6
β-strand	552	1	31
β-strand	553-556	4	23
β-strand	557	1	32
α-helix	565-567	3
β-strand	568	1	29
α-helix	573-577	5
α-helix	583-603	21
α-helix	613-626	14
α-helix	629-634	6
α-helix	640-662	23
α-helix	668-681	14
α-helix	683-685	3
β-strand	686	1	34
β-strand	699	1	34
α-helix	709-716	8
α-helix	717-719	3
α-helix	728-748	21

Chain D: 30 helices, 35 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	150-152	3
α-helix	160-175	16
β-strand	183-193	11	35
α-helix	197-198	2
β-strand	199-203	5	36
β-strand	214	1	36
β-strand	220	1	37
β-strand	226-230	5	36
β-strand	232-234	3	38
β-strand	254-258	5	38
α-helix	264-273	10
β-strand	279-282	4	38
β-strand	297	1	39
β-strand	299	1	37
β-strand	334-337	4	38
α-helix	339-347	9
β-strand	349	1	40
β-strand	366	1	38
β-strand	367	1	40
β-strand	372-377	6	36
β-strand	379-389	11	35
β-strand	392-393	2	41
β-strand	398	1	42
β-strand	402-406	5	41
α-helix	416-421	6
α-helix	422-435	14
α-helix	436-440	5
β-strand	446	1	42
β-strand	448-451	4	41
β-strand	452	1	35
α-helix	456-458	3
α-helix	461-467	7
α-helix	468-470	3
α-helix	474-476	3
β-strand	478-483	6	41
β-strand	488	1	43
β-strand	495-498	4	44
α-helix	500-502	3
α-helix	503-510	8
α-helix	513	1
β-strand	514	1	45
α-helix	515	1
β-strand	521	1	45
β-strand	527-529	3	46
β-strand	532-533	2	44
α-helix	534-536	3
α-helix	541-546	6
β-strand	552	1	41
β-strand	553-556	4	44
β-strand	557	1	43
β-strand	568	1	39
α-helix	573-577	5
α-helix	583-603	21
α-helix	613-626	14
α-helix	629-634	6
α-helix	640-662	23
α-helix	668-681	14
α-helix	683-685	3
β-strand	686	1	47
β-strand	699	1	47
α-helix	709-716	8
α-helix	717-721	5
α-helix	728-748	21

Chain E: 31 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	150-152	3
α-helix	160-175	16
β-strand	183-193	11	48
α-helix	197-198	2
β-strand	199-203	5	49
β-strand	214	1	49
β-strand	220	1	50
β-strand	226-230	5	49
β-strand	232-234	3	51
β-strand	254-258	5	51
α-helix	264-273	10
β-strand	279-282	4	51
β-strand	297	1	52
β-strand	299	1	50
β-strand	334-337	4	51
α-helix	339-347	9
β-strand	349	1	53
β-strand	366	1	51
β-strand	367	1	53
β-strand	372-377	6	49
β-strand	379-389	11	48
β-strand	392-393	2	54
β-strand	398-406	9	54
α-helix	416-421	6
α-helix	422-435	14
α-helix	436-440	5
β-strand	446-451	6	54
β-strand	452	1	48
α-helix	456-458	3
α-helix	461-467	7
α-helix	468-470	3
α-helix	474-477	4
β-strand	478-483	6	54
β-strand	495-498	4	46
α-helix	500-502	3
α-helix	503-510	8
α-helix	513	1
β-strand	514	1	55
α-helix	515	1
β-strand	521	1	55
β-strand	527-529	3	44
β-strand	532-533	2	46
α-helix	534-536	3
α-helix	541-546	6
β-strand	552	1	54
β-strand	553-556	4	46
α-helix	565-567	3
β-strand	568	1	52
α-helix	573-577	5
α-helix	583-603	21
α-helix	613-626	14
α-helix	629-634	6
α-helix	640-662	23
α-helix	668-681	14
α-helix	683-685	3
β-strand	686	1	56
β-strand	699	1	56
α-helix	709-716	8
α-helix	717-721	5
α-helix	728-748	21

Chain G: 28 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	150-152	3
α-helix	160-175	16
β-strand	183-193	11	69
α-helix	197-198	2
β-strand	199-203	5	70
β-strand	214	1	70
β-strand	220	1	71
β-strand	226-230	5	70
β-strand	232-234	3	72
β-strand	254-258	5	72
α-helix	264-273	10
β-strand	279-282	4	72
β-strand	297	1	73
β-strand	299	1	71
β-strand	334-337	4	72
α-helix	339-347	9
β-strand	349	1	74
β-strand	366	1	72
β-strand	367	1	74
β-strand	372-377	6	70
β-strand	379-389	11	69
β-strand	392-393	2	75
β-strand	398-406	9	75
α-helix	416-421	6
α-helix	422-438	17
β-strand	446-451	6	75
β-strand	452	1	69
α-helix	456-458	3
α-helix	461-468	8
α-helix	474-477	4
β-strand	478-483	6	75
β-strand	495-498	4	67
α-helix	500-502	3
α-helix	503-510	8
α-helix	513	1
β-strand	514	1	76
α-helix	515	1
β-strand	521	1	76
β-strand	527-529	3	65
β-strand	532-533	2	67
α-helix	534-536	3
α-helix	541-546	6
β-strand	552	1	75
β-strand	553-556	4	67
β-strand	568	1	73
α-helix	573-577	5
α-helix	583-603	21
α-helix	613-626	14
α-helix	629-634	6
α-helix	640-662	23
α-helix	668-681	14
α-helix	683-685	3
β-strand	686	1	77
β-strand	699	1	77
α-helix	709-716	8
α-helix	717-721	5
α-helix	728-748	21

Chain H: 28 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	150-152	3
α-helix	160-175	16
β-strand	183-193	11	78
α-helix	197-198	2
β-strand	199-203	5	79
β-strand	214	1	79
β-strand	220	1	80
β-strand	226-230	5	79
β-strand	232-234	3	81
β-strand	254-258	5	81
α-helix	264-273	10
β-strand	279-282	4	81
β-strand	297	1	82
β-strand	299	1	80
β-strand	334-337	4	81
α-helix	339-347	9
β-strand	349	1	83
β-strand	366	1	81
β-strand	367	1	83
β-strand	372-377	6	79
β-strand	379-389	11	78
β-strand	392-393	2	84
β-strand	398-406	9	84
α-helix	416-421	6
α-helix	422-438	17
β-strand	446-451	6	84
β-strand	452	1	78
α-helix	456-458	3
α-helix	461-468	8
α-helix	474-477	4
β-strand	478-483	6	84
β-strand	495-498	4	85
α-helix	500-502	3
α-helix	503-510	8
α-helix	513	1
β-strand	514	1	86
α-helix	515	1
β-strand	521	1	86
β-strand	533	1	85
α-helix	534-536	3
α-helix	541-546	6
β-strand	552	1	84
β-strand	553-556	4	85
β-strand	568	1	82
α-helix	573-577	5
α-helix	583-603	21
α-helix	613-626	14
α-helix	629-634	6
α-helix	640-662	23
α-helix	668-681	14
α-helix	683-685	3
β-strand	686	1	87
β-strand	699	1	87
α-helix	709-716	8
α-helix	717-719	3
α-helix	728-748	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transferrin receptor protein	A, B, C, D, E, F, G, H	protein	639	Homo sapiens	P02786 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>1CX8_1 TRANSFERRIN RECEPTOR PROTEIN (chains A, B, C, D, E, F, G, H)
LYWDDLKRKLSEKLDSTDFTSTIKLLNENSYVPREAGSQKDENLALYVENEFREFKLSKV
WRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKK
DFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHA
HLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDS
TCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGV
GTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTY
INLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAA
FPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKL
THDVELNLDYEEYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFG
NAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQ
NNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	24
SM	Samarium (III) ion	Sm	24

Primary citation

Crystal structure of the ectodomain of human transferrin receptor. Lawrence, C.M., Ray, S., Babyonyshev, M. et al. Science (1999) 286:779-782. DOI 10.1126/science.286.5440.779 · PubMed

Other PDB entries of the same protein (UniProt P02786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OKD 1.85 Å, Crystal Structure of human transferrin receptor in complex with a cystine-dense peptide
8P0Z 1.88 Å, AP01-S2.3 - a variant of a redesigned transferrin receptor apical domain
6Y76 1.98 Å, AP01 - a redesigned transferrin receptor apical domain
9GH7 2.08 Å, Complex of human TfR1 with a potent bicyclic peptide
11QC 2.4 Å, Human transferrin receptor ectodomain
11RN 2.4 Å, Complex of B19V VP1u RBD and human transferrin receptor ectodomain
3KAS 2.4 Å, Machupo virus GP1 bound to human transferrin receptor 1
6WRV 2.47 Å, Crystal structure of computationally designed protein 3DS18 in complex with the human…
7ZQS 2.54 Å, Cryo-EM Structure of Human Transferrin Receptor 1 bound to DNA Aptamer
1DE4 2.8 Å, Hemochromatosis protein hfe complexed with transferrin receptor
6WRW 2.84 Å, Crystal structure of computationally designed protein 2DS25.5 in complex with the human…
6WRX 3.07 Å, Crystal structure of computationally designed protein 2DS25.1 in complex with the human…

Browse structure collections

About this viewer

MolViewer shows 1CX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.