9GH7: Transferrin receptor protein 1

Complex of human TfR1 with a potent bicyclic peptide. Determined by X-ray diffraction at 2.08 Å resolution. Released 30 Apr 2025.

Method: X-ray diffraction
Resolution: 2.08 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 5,290
Mol. weight: 78.82 kDa
Ligands: A1ILE, CA
Released: 30 Apr 2025

Explore 9GH7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GH7 contains 32 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	124-137	14
α-helix	140-147	8
α-helix	150-152	3
β-strand	155	1	1
α-helix	160-175	16
β-strand	180-193	14	2
β-strand	199-204	6	3
β-strand	209-214	6	3
β-strand	220-221	2	4
α-helix	223-225	3
β-strand	226-230	5	3
β-strand	232-234	3	5
α-helix	240-244	5
β-strand	254-258	5	5
β-strand	260	1	6
β-strand	262	1	6
α-helix	264-273	10
β-strand	278-282	5	5
β-strand	299-300	2	4
α-helix	317-319	3
β-strand	334-336	3	5
α-helix	339-346	8
β-strand	349-350	2	5
α-helix	355-357	3
β-strand	366-367	2	5
β-strand	371-377	7	3
β-strand	379-393	15	2
β-strand	398-408	11	2
β-strand	411	1	1
α-helix	416-420	5
α-helix	421-438	18
β-strand	446-453	8	2
α-helix	456-458	3
α-helix	461-474	14
β-strand	478-483	6	2
β-strand	488	1	2
β-strand	493-498	6	2
α-helix	500-502	3
α-helix	503-510	8
β-strand	514	1	7
β-strand	521	1	7
α-helix	528-531	4
α-helix	532-535	4
α-helix	541-546	6
β-strand	552-558	7	2
α-helix	562-563	2
α-helix	573-579	7
α-helix	583-602	20
α-helix	611-613	3
α-helix	614-626	13
α-helix	629-634	6
α-helix	640-661	22
α-helix	668-678	11
α-helix	683-685	3
β-strand	686	1	8
β-strand	699	1	8
α-helix	709-721	13
α-helix	728-749	22
α-helix	753-755	3

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transferrin receptor protein 1	A	protein	678	Homo sapiens	P02786 (AlphaFold model)
Bicyclic peptide	P	protein	15	synthetic construct

Sequence of entity 1 (A), FASTA

>9GH7_1 Transferrin receptor protein 1 (chains A)
HHHHHHCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTG
TIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVII
VDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKI
TFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFP
PSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLK
EIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGF
QPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLL
YTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTD
YPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFV
RDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVE
YHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTI
QGAANALSGDVWDIDNEF

Sequence of entity 2 (P), FASTA

>9GH7_2 Bicyclic peptide (chains P)
ACPPDAHLGCISWCA

Ligands and cofactors

ID	Name	Formula	Copies
A1ILE	1-(3,5-diethanoyl-1,3,5-triazinan-1-yl)ethanone	C9 H15 N3 O3	1
CA	Calcium ion	Ca	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Conjugation to a transferrin receptor 1-binding Bicycle peptide enhances ASO and siRNA potency in skeletal and cardiac muscles. Ostergaard, M.E., Carrer, M., Anderson, B.A. et al. Nucleic Acids Res (2025) 53. DOI 10.1093/nar/gkaf270 · PubMed

Other PDB entries of the same protein (UniProt P02786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OKD 1.85 Å, Crystal Structure of human transferrin receptor in complex with a cystine-dense peptide
8P0Z 1.88 Å, AP01-S2.3 - a variant of a redesigned transferrin receptor apical domain
6Y76 1.98 Å, AP01 - a redesigned transferrin receptor apical domain
11QC 2.4 Å, Human transferrin receptor ectodomain
11RN 2.4 Å, Complex of B19V VP1u RBD and human transferrin receptor ectodomain
3KAS 2.4 Å, Machupo virus GP1 bound to human transferrin receptor 1
6WRV 2.47 Å, Crystal structure of computationally designed protein 3DS18 in complex with the human…
7ZQS 2.54 Å, Cryo-EM Structure of Human Transferrin Receptor 1 bound to DNA Aptamer
1DE4 2.8 Å, Hemochromatosis protein hfe complexed with transferrin receptor
6WRW 2.84 Å, Crystal structure of computationally designed protein 2DS25.5 in complex with the human…
6WRX 3.07 Å, Crystal structure of computationally designed protein 2DS25.1 in complex with the human…
1CX8 3.2 Å, Crystal structure of the ectodomain of human transferrin receptor

Browse structure collections

About this viewer

MolViewer shows 9GH7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.