NMR solution structure of complement-like repeat CR3 from the low density lipoprotein receptor-related protein (LRP). Evidence for specific binding to the receptor binding domain of human alpha-2 macroglobulin. Determined by solution NMR. Released 14 Jan 2000.
Explore 1D2L in 3D Show helices and sheets RCSB PDB PDBe
1D2L contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| β-strand | 7-8 | 2 | 1 |
| β-strand | 11-13 | 3 | 2 |
| β-strand | 17-19 | 3 | 2 |
| α-helix | 21-23 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lipoprotein receptor related protein | A | protein | 45 | Homo sapiens | Q07954 (AlphaFold model) |
>1D2L_1 LIPOPROTEIN RECEPTOR RELATED PROTEIN (chains A) GSPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
NMR solution structure of complement-like repeat CR3 from the low density lipoprotein receptor-related protein. Evidence for specific binding to the receptor binding domain of human alpha(2)-macroglobulin. Dolmer, K., Huang, W., Gettins, P.G. J Biol Chem (2000) 275:3264-3269. DOI 10.1074/jbc.275.5.3264 · PubMed
Other PDB entries of the same protein (UniProt Q07954 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1D2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.