Crystal structure of ligand-binding repeat CR7 from LRP. Determined by X-ray diffraction at 1.85 Å resolution. Released 19 Dec 2001.
Explore 1J8E in 3D Show helices and sheets RCSB PDB PDBe
1J8E contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-11 | 3 | 1 |
| β-strand | 17-19 | 3 | 1 |
| α-helix | 20-22 | 3 | |
| α-helix | 34-36 | 3 | |
| α-helix | 38-41 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Low-density lipoprotein receptor-related protein 1 | A | protein | 44 | Homo sapiens | Q07954 (AlphaFold model) |
>1J8E_1 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROTEIN 1 (chains A) GSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Calcium coordination and pH dependence of the calcium affinity of ligand-binding repeat CR7 from the LRP. Comparison with related domains from the LRP and the LDL receptor. Simonovic, M., Dolmer, K., Huang, W. et al. Biochemistry (2001) 40:15127-15134. DOI 10.1021/bi015688m · PubMed
Other PDB entries of the same protein (UniProt Q07954 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1J8E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.