1D3L: Protein

D1D2-icam-1 fully glycosylated, variation of D1-D2 interdomain angle in different crystal structures. Determined by X-ray diffraction at 3.25 Å resolution. Released 1 Dec 1999.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: Homo sapiens
Chains: 1
Atoms: 185
Mol. weight: 20.44 kDa
Released: 1 Dec 1999

Explore 1D3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1D3L contains 2 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	8-12	5	2
β-strand	17-23	7	1
β-strand	30-34	5	3
β-strand	38-42	5	1
β-strand	49-55	7	1
β-strand	64-68	5	3
β-strand	73-77	5	3
β-strand	79-83	5	2
β-strand	88-91	4	4
β-strand	103-111	9	4
α-helix	116-118	3
β-strand	119-125	7	5
β-strand	128-134	7	5
β-strand	140-147	8	4
β-strand	157-164	8	5
α-helix	166-168	3
β-strand	172-176	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (intercellular adhesion molecule-1)	A	protein	185	Homo sapiens	P05362 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1D3L_1 PROTEIN (INTERCELLULAR ADHESION MOLECULE-1) (chains A)
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQED
SQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLT
VVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPY
QLQTF

Primary citation

Structural studies of two rhinovirus serotypes complexed with fragments of their cellular receptor. Kolatkar, P.R., Bella, J., Olson, N.H. et al. EMBO J (1999) 18:6249-6259. DOI 10.1093/emboj/18.22.6249 · PubMed

Other PDB entries of the same protein (UniProt P05362 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IAM 2.1 Å, Structure of the two amino-terminal domains of human intercellular adhesion molecule-1,…
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
2OZ4 2.7 Å, Structural Plasticity in IgSF Domain 4 of ICAM-1 Mediates Cell Surface Dimerization
5MZA 2.78 Å, The DBLb domain of PF11_0521 PfEMP1 bound to human ICAM-1
1IC1 3.0 Å, The crystal structure for the N-terminal two domains of icam-1
1P53 3.06 Å, The Crystal Structure of ICAM-1 D3-D5 fragment
1MQ8 3.3 Å, Crystal structure of alphaL I domain in complex with ICAM-1
3TCX 3.6 Å, Structure of Engineered Single Domain ICAM-1 D1 with High-Affinity aL Integrin I Domain…
6S8U 3.67 Å, Structure of the PfEMP1 IT4var13 DBLbeta domain bound to ICAM-1
6EIT 3.9 Å, Coxsackievirus A24v in complex with the D1-D2 fragment of ICAM-1
1Z7Z 8.0 Å, Cryo-em structure of human coxsackievirus A21 complexed with five domain icam-1kilifi
1D3I 26.0 Å, cryo-EM structure of human rhinovirus 14 (HRV14) complexed with a two-domain fragment of…

Browse structure collections

About this viewer

MolViewer shows 1D3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.