7BG7: HRV14

Name: PDB 7BG7: HRV14 in complex with its receptor ICAM-1
Published: 2021-05-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

HRV14 in complex with its receptor ICAM-1. Determined by electron microscopy at 2.4 Å resolution. Released 19 May 2021.

Method: Electron microscopy
Resolution: 2.4 Å
Organisms: Human rhinovirus 14, Homo sapiens
Chains: 5
Atoms: 7,332
Mol. weight: 144.45 kDa
Released: 19 May 2021

Explore 7BG7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BG7 contains 39 α-helices and 65 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	18-20	3	1
β-strand	23	1	2
β-strand	34-35	2	3
α-helix	37-39	3
α-helix	47-49	3
β-strand	53	1	2
β-strand	56-57	2	1
β-strand	66	1	4
α-helix	67-70	4
β-strand	75-84	10	5
β-strand	99-103	5	6
α-helix	110-117	8
β-strand	119-135	17	5
β-strand	147-153	7	6
α-helix	154	1
α-helix	157-160	4
α-helix	166-169	4
β-strand	175-179	5	6
β-strand	183-188	6	5
β-strand	197-198	2	5
β-strand	203	1	7
α-helix	217-219	3
β-strand	223-228	6	6
β-strand	237-255	19	5
α-helix	257-258	2
β-strand	259	1	8
α-helix	275-277	3
α-helix	280-282	3

Chain 2: 17 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	9
β-strand	21-25	5	9
α-helix	30	1
β-strand	31-33	3	10
α-helix	34-36	3
α-helix	41-43	3
α-helix	44-46	3
α-helix	52-53	2
β-strand	54	1	10
β-strand	64-65	2	10
α-helix	66-68	3
β-strand	69-72	4	11
β-strand	78-82	5	12
α-helix	84-86	3
α-helix	90-98	9
β-strand	99-111	13	10
β-strand	119-128	10	12
α-helix	131-133	3
β-strand	134	1	13
α-helix	140-143	4
α-helix	144-147	4
β-strand	154-155	2	12
α-helix	164	1
β-strand	165	1	13
α-helix	166	1
α-helix	169-171	3
β-strand	176	1	8
α-helix	178-183	6
β-strand	186-190	5	12
β-strand	196-201	6	10
β-strand	210	1	10
β-strand	215	1	7
β-strand	218-229	12	12
α-helix	230-231	2
β-strand	237-240	4	11
β-strand	241-254	14	10
α-helix	257-258	2

Chain 3: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	23	1	5
α-helix	30-35	6
β-strand	39-40	2	5
β-strand	42	1	4
β-strand	51-52	2	3
α-helix	64-67	4
β-strand	68-71	4	3
β-strand	79-84	6	14
α-helix	90-92	3
α-helix	96-101	6
β-strand	104	1	15
β-strand	106-108	3	16
β-strand	111-117	7	3
β-strand	124-132	9	14
α-helix	137-139	3
α-helix	142-145	4
β-strand	149-155	7	14
β-strand	160-165	6	3
β-strand	174-175	2	16
β-strand	186-196	11	14
α-helix	197-198	2
β-strand	205-213	9	3
β-strand	218-219	2	16
β-strand	222	1	15

Chain 4: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	35-37	3
α-helix	50-53	4
β-strand	56-57	2	10
α-helix	59-61	3

Chain B: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	17
β-strand	8-12	5	18
β-strand	17-22	6	17
β-strand	31-34	4	19
β-strand	41	1	17
β-strand	49-54	6	17
β-strand	61	1	18
β-strand	64-67	4	19
β-strand	75-77	3	19
β-strand	79-83	5	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	1	protein	293	Human rhinovirus 14	P03303 (AlphaFold model)
Genome polyprotein	2	protein	262	Human rhinovirus 14	P03303 (AlphaFold model)
Genome polyprotein	3	protein	236	Human rhinovirus 14	P03303 (AlphaFold model)
Genome polyprotein	4	protein	68	Human rhinovirus 14	P03303 (AlphaFold model)
Intercellular adhesion molecule 1	B	protein	453	Homo sapiens	P05362 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>7BG7_1 Genome polyprotein (chains 1)
ALTEGLGDELEEVIVEKTKQTVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTT
YMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKL
ELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSV
FFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHK
TLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY

Sequence of entity 2 (2), FASTA

>7BG7_2 Genome polyprotein (chains 2)
SPNVEACGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSV
CRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSG
CLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVIYNMNGTLLGN
LLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPI
TVTIAPMCTEFSGIRSKSIVPQ

Sequence of entity 3 (3), FASTA

>7BG7_3 Genome polyprotein (chains 3)
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHT
KDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGP
ALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDT
YTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE

Sequence of entity 4 (4), FASTA

>7BG7_4 Genome polyprotein (chains 4)
GAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDLM
LKGAPALN

Sequence of entity 5 (B), FASTA

>7BG7_5 Intercellular adhesion molecule 1 (chains B)
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQED
SQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLT
VVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPY
QLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGN
DSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTE
VTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQT
RELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTV
TRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Primary citation

ICAM-1 induced rearrangements of capsid and genome prime rhinovirus 14 for activation and uncoating. Hrebik, D., Fuzik, T., Gondova, M. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2024251118 · PubMed

Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
9LGP 2.11 Å, Crystal structure of the HRV B14 3C protease in complex with AG7404
5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
6KZ0 2.4 Å, HRV14 3C in complex with single chain antibody GGVV
1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
5W3E 2.53 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG6 2.6 Å, HRV14 native particle solved by cryoEM
31LE 2.64 Å, HRV E1007A mutant
1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
31LF 2.71 Å, HRV virion E2250A mutant
5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…
29UB 2.73 Å, HRV B14 virion

Browse structure collections

About this viewer

MolViewer shows 7BG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.