1DEG: Calmodulin

The linker of des-GLU84 calmodulin is bent as seen in the crystal structure. Determined by X-ray diffraction at 2.9 Å resolution. Released 31 May 1994.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Bos taurus
Chains: 1
Atoms: 146
Mol. weight: 16.19 kDa
Ligands: CA
Released: 31 May 1994

Explore 1DEG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DEG contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-19	15
β-strand	26-28	3	1502
α-helix	29-38	10
α-helix	45-55	11
β-strand	62-64	3	1502
α-helix	65-80	16
α-helix	86-92	7
β-strand	99-101	3	2
α-helix	102-111	10
α-helix	118-128	11
β-strand	135-137	3	2
α-helix	138-147	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	142	Bos taurus	P62157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DEG_1 CALMODULIN (chains A)
TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID
FPEFLTMMARKMKDTDSEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMI
REANIDGDGQVNYEEFVQMMTA

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

The linker of des-Glu84-calmodulin is bent. Raghunathan, S., Chandross, R.J., Cheng, B.P. et al. Proc Natl Acad Sci U S A (1993) 90:6869-6873. DOI 10.1073/pnas.90.14.6869 · PubMed

Other PDB entries of the same protein (UniProt P62157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IF7 1.6 Å, Structure of Calmodulin complexed with its first endogenous inhibitor,…
1FW4 1.7 Å, Crystal structure of E. Coli fragment TR2C from calmodulin to 1.7 a resolution
1PRW 1.7 Å, Crystal structure of bovine brain Ca++ calmodulin in a compact form
1CDM 2.0 Å, Modulation of calmodulin plasticity in molecular recognition on the basis of X-ray…
1CM1 2.0 Å, Motions of calmodulin-single-conformer refinement
1CM4 2.0 Å, Motions of calmodulin-four-conformer refinement
1LIN 2.0 Å, Calmodulin complexed with trifluoperazine (1:4 complex)
1XA5 2.12 Å, Structure of Calmodulin in complex with KAR-2, a bis-indol alkaloid
2F2O 2.17 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…
1QIW 2.3 Å, Calmodulin complexed with N-(3,3,-diphenylpropyl)-N'-[1-R-(3,4-bis-butoxyphenyl)-ethyl]-p…
2FOT 2.45 Å, Crystal structure of the complex between calmodulin and alphaII-spectrin
2F2P 2.6 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…

Browse structure collections

About this viewer

MolViewer shows 1DEG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.