1DG6: APO2L/TRAIL

Crystal structure of APO2L/TRAIL. Determined by X-ray diffraction at 1.3 Å resolution. Released 26 Jan 2000.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,477
Mol. weight: 22.21 kDa
Ligands: ZN
Released: 26 Jan 2000

Explore 1DG6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DG6 contains 3 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	123-127	5	1
α-helix	144-147	4
β-strand	149-150	2	2
β-strand	163-165	3	1
β-strand	167-170	4	2
β-strand	173-176	4	2
β-strand	180-193	14	1
β-strand	205-213	9	2
β-strand	220-228	9	2
α-helix	229-230	2
β-strand	237-250	14	1
β-strand	255-260	6	2
α-helix	263-265	3
β-strand	266-267	2	1
β-strand	274-279	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
APO2L/TNF-related apopotis inducing ligand (TRAIL)	A	protein	191	Homo sapiens	P50591 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DG6_1 APO2L/TNF-RELATED APOPOTIS INDUCING LIGAND (TRAIL) (chains A)
MILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRK
INSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYI
YKYTSYPAPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDH
EASFFGAFLVG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (CL) are not listed.

Primary citation

A unique zinc-binding site revealed by a high-resolution X-ray structure of homotrimeric Apo2L/TRAIL. Hymowitz, S.G., O'Connell, M.P., Ultsch, M.H. et al. Biochemistry (2000) 39:633-650. DOI 10.1021/bi992242l · PubMed

Other PDB entries of the same protein (UniProt P50591 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1D4V 2.2 Å, Crystal structure of trail-DR5 complex
1DU3 2.2 Å, Crystal structure of TRAIL-SDR5
1D0G 2.4 Å, Crystal structure of death receptor 5 (DR5) bound to APO2L/TRAIL
1D2Q 2.8 Å, Crystal structure of human trail
5CIR 3.0 Å, Crystal structure of death receptor 4 (DR4; TNFFRSF10A) bound to TRAIL (TNFSF10)
4N90 3.3 Å, Crystal structure of ternary complex of TRAIL, DR5, and Fab fragment from a DR5 agonist…

Browse structure collections

About this viewer

MolViewer shows 1DG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.