1DLF: Anti-dansyl immunoglobulin IGG2A

Name: PDB 1DLF: High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody IGG2A(S) crystallized at PH 5.25
Published: 1999-07-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: immunoglobulin

High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody IGG2A(S) crystallized at PH 5.25. Determined by X-ray diffraction at 1.45 Å resolution. Released 26 Jul 1999.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,394
Mol. weight: 26.92 kDa
Released: 26 Jul 1999

Explore 1DLF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DLF contains 5 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	4
β-strand	11-12	2	5
β-strand	18-25	8	4
β-strand	33-40	8	6
β-strand	44-51	8	6
α-helix	52B-53	3
β-strand	57-59	3	6
β-strand	67-72	6	4
β-strand	77-82	6	4
α-helix	84-86	3
β-strand	88-95	8	6
β-strand	96	1	7
β-strand	99	1	7
β-strand	109-111	3	6
β-strand	112-113	2	5

Chain L: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Anti-dansyl immunoglobulin IGG2A(S)	L	protein	113	Mus musculus	P01631 (AlphaFold model)
Anti-dansyl immunoglobulin IGG2A(S)	H	protein	124	Mus musculus

Sequence of entity 1 (L), FASTA

>1DLF_1 ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (chains L)
DVVMTQTPLSLPVSLGNQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKR

Sequence of entity 2 (H), FASTA

>1DLF_2 ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (chains H)
EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHAT
YYAESVKGRFTISRDDSKRRVYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVS
AEPR

Primary citation

The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody. Nakasako, M., Takahashi, H., Shimba, N. et al. J Mol Biol (1999) 291:117-134. DOI 10.1006/jmbi.1999.2931 · PubMed

Other PDB entries of the same protein (UniProt P01631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DLF 1.55 Å, High resolution crystal structure of the fv fragment from an anti-dansyl switch variant…
1N4X 1.7 Å, Structure of scFv 1696 at acidic pH
1WZ1 1.85 Å, Crystal structure of the Fv fragment complexed with dansyl-lysine
1SVZ 1.89 Å, Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope…
2IPT 2.0 Å, PFA1 Fab Fragment
2IQA 2.0 Å, PFA2 FAB fragment, monoclinic apo form
2HKF 2.01 Å, Crystal structure of the Complex Fab M75- Peptide
2O5X 2.05 Å, Crystal structure of 1E9 LeuH47Trp/ArgH100Trp, an engineered Diels-Alderase Fab with nM…
1BFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
1CFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
2HKH 2.1 Å, Crystal structure of the Fab M75
2O5Z 2.4 Å, Crystal structure of the 1E9 LeuH47Trp/ArgH100Trp Fab 5-beta-androstane-3,17-dione complex

Browse structure collections

About this viewer

MolViewer shows 1DLF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.