1DR9: Soluble form of B7-1

Crystal structure of a soluble form of B7-1 (CD80). Determined by X-ray diffraction at 3.0 Å resolution. Released 10 Jan 2000.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,645
Mol. weight: 23.66 kDa
Ligands: NAG
Released: 10 Jan 2000

Explore 1DR9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DR9 contains 5 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	12-14	3	2
α-helix	24-27	4
β-strand	29-34	6	1
β-strand	37-43	7	1
β-strand	46-49	4	1
α-helix	51-54	4
β-strand	57-60	4	2
β-strand	66-69	4	2
α-helix	74-76	3
β-strand	78-86	9	1
β-strand	93-105	13	1
α-helix	107-111	5
β-strand	112-117	6	3
β-strand	123-133	11	3
β-strand	137-143	7	4
β-strand	147-148	2	4
α-helix	149-150	2
β-strand	152-157	6	3
β-strand	164-173	10	3
β-strand	178-186	9	4
β-strand	191-197	7	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T lymphocyte activation antigen	A	protein	201	Homo sapiens	P33681 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DR9_1 T LYMPHOCYTE ACTIVATION ANTIGEN (chains A)
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFD
ITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPT
SNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSF
MCLIKYGHLRVNQTFNWNTAK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Structure and dimerization of a soluble form of B7-1. Ikemizu, S., Gilbert, R.J., Fennelly, J.A. et al. Immunity (2000) 12:51-60. DOI 10.1016/S1074-7613(00)80158-2 · PubMed

Other PDB entries of the same protein (UniProt P33681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FXW 2.7 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (hexameric ring)
8FXZ 2.86 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (heptameric ring)
1I8L 3.0 Å, Human B7-1/CTLA-4 co-stimulatory complex
8HXA 3.04 Å, Cryo-EM structure of MPXV M2 in complex with human B7.1
7TPS 3.15 Å, Crystal structure of ALPN-202 (engineered CD80 vIgD) in complex with PD-L1

Browse structure collections

About this viewer

MolViewer shows 1DR9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.