Crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Jan 1992.
Explore 1DTX in 3D Show helices and sheets RCSB PDB PDBe
1DTX contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-8 | 4 | |
| α-helix | 10-11 | 2 | |
| β-strand | 20-26 | 7 | 1 |
| β-strand | 31-37 | 7 | 1 |
| β-strand | 47 | 1 | 1 |
| α-helix | 50-53 | 4 | |
| α-helix | 54-58 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-dendrotoxin | A | protein | 59 | Dendroaspis angusticeps | P00980 (AlphaFold model) |
>1DTX_1 ALPHA-DENDROTOXIN (chains A) QPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG
Crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor. Skarzynski, T. J Mol Biol (1992) 224:671-683. DOI 10.1016/0022-2836(92)90552-U · PubMed
Other PDB entries of the same protein (UniProt P00980 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1DTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.