1EA3: Influenza virus M1 protein

Name: PDB 1EA3: Influenza virus M1 protein
Published: 2001-04-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: influenza virus

Influenza virus M1 protein. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Apr 2001.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: INFLUENZA A VIRUS
Chains: 2
Atoms: 2,499
Mol. weight: 36.42 kDa
Released: 26 Apr 2001

Explore 1EA3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EA3 contains 23 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-13	11
α-helix	16	1
α-helix	19-31	13
α-helix	39-47	9
α-helix	54-66	13
α-helix	74-76	3
α-helix	78-84	7
α-helix	92-103	12
α-helix	109-116	8
α-helix	121-133	13
α-helix	135-137	3
α-helix	140-157	18

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-13	11
α-helix	16	1
α-helix	19-31	13
α-helix	39-47	9
α-helix	54-66	13
α-helix	78-85	8
α-helix	90-103	14
α-helix	109-116	8
α-helix	121-132	12
α-helix	135-137	3
α-helix	140-156	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix protein M1	A, B	protein	164	INFLUENZA A VIRUS	P03485 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1EA3_1 MATRIX PROTEIN M1 (chains A, B)
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGIL
GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYS
AGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQ

Primary citation

Combined Results from Solution Studies on Intact Influenza Virus M1 Protein and from a New Crystal Form of its N-Terminal Domain Show that M1 is an Elongated Monomeric. Arzt, S., Baudin, F., Barge, A. et al. Virology (2001) 279:439. DOI 10.1006/VIRO.2000.0727 · PubMed

Other PDB entries of the same protein (UniProt P03485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VLL 1.6 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5TEZ 1.7 Å, TCR F50 recgonizing M1-HLA-A2
5ISZ 2.06 Å, Crystal structure of LS01-TCR/M1-HLA-A*02 complex
1AA7 2.08 Å, Influenza virus matrix protein crystal structure at PH 4.0
5CQE 2.1 Å, 2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from…
5EUO 2.1 Å, PF6-M1-HLA-A2
2VLR 2.3 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5JHD 2.46 Å, Crystal structure of LS10-TCR/M1-HLA-A*02 complex
1HHI 2.5 Å, The antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation…
3VDX 3.0 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
7JM3 3.4 Å, Full-length three-dimensional structure of the influenza A virus M1 protein and its…
4IQ4 3.5 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…

Browse structure collections

About this viewer

MolViewer shows 1EA3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.