Protease inhibitor ecotin. Determined by X-ray diffraction at 2.19 Å resolution. Released 12 Feb 1997.
Explore 1ECY in 3D Show helices and sheets RCSB PDB PDBe
1ECY contains 5 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-16 | 4 | |
| β-strand | 20 | 1 | 1 |
| β-strand | 23-25 | 3 | 2 |
| α-helix | 33-35 | 3 | |
| β-strand | 36-48 | 13 | 3 |
| β-strand | 55 | 1 | 4 |
| β-strand | 56-63 | 8 | 2 |
| β-strand | 70-78 | 9 | 2 |
| β-strand | 93-98 | 6 | 3 |
| β-strand | 99 | 1 | 4 |
| α-helix | 102-105 | 4 | |
| β-strand | 106-108 | 3 | 3 |
| β-strand | 115-118 | 4 | 2 |
| β-strand | 120 | 1 | 1 |
| β-strand | 124-131 | 8 | 3 |
| α-helix | 132 | 1 | |
| α-helix | 139-141 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ecotin | A | protein | 142 | Escherichia coli | P23827 (AlphaFold model) |
>1ECY_1 ECOTIN (chains A) AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLE NKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTP DNVDVKYRVWKAEEKIDNAVVR
Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability. Shin, D.H., Song, H.K., Seong, I.S. et al. Protein Sci (1996) 5:2236-2247. PubMed
Other PDB entries of the same protein (UniProt P23827 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ECY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.