1EDU: Enth domain of rat epsin 1

Crystal structure of the enth domain of rat epsin 1. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 May 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,289
Mol. weight: 17.81 kDa
Released: 10 May 2000

Explore 1EDU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EDU contains 12 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
α-helix	9-17	9
α-helix	24-26	3
α-helix	27-36	10
α-helix	40-54	15
α-helix	58-60	3
α-helix	61-77	17
α-helix	80-88	9
α-helix	90-94	5
α-helix	95-98	4
β-strand	102	1	1
β-strand	108	1	1
α-helix	110-125	16
α-helix	127-145	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EH domain binding protein EPSIN	A	protein	149	Rattus norvegicus	O88339 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EDU_1 EH domain binding protein EPSIN (chains A)
NIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNW
RHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLV
ALLRDEDRLREERAHALKTKEKLAQTATA

Primary citation

Epsin 1 undergoes nucleocytosolic shuttling and its eps15 interactor NH(2)-terminal homology (ENTH) domain, structurally similar to Armadillo and HEAT repeats, interacts with the transcription factor promyelocytic leukemia Zn(2)+ finger protein (PLZF). Hyman, J., Chen, H., Di Fiore, P.P. et al. J Cell Biol (2000) 149:537-546. DOI 10.1083/jcb.149.3.537 · PubMed

Other PDB entries of the same protein (UniProt O88339 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EYH 1.56 Å, Crystal structure of the epsin N-terminal homology (ENTH) domain at 1.56 Å resolution
1H0A 1.7 Å, Epsin ENTH bound to Ins(1,4,5)P3
1KY6 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide

Browse structure collections

About this viewer

MolViewer shows 1EDU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.