Crystal structure of the human co-chaperone P23. Determined by X-ray diffraction at 2.49 Å resolution. Released 19 Jun 2000.
Explore 1EJF in 3D Show helices and sheets RCSB PDB PDBe
1EJF contains 2 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| α-helix | 3-5 | 3 | |
| β-strand | 6-10 | 5 | 2 |
| β-strand | 14-19 | 6 | 2 |
| β-strand | 24-32 | 9 | 1 |
| β-strand | 35-42 | 8 | 1 |
| β-strand | 47-54 | 8 | 1 |
| β-strand | 55 | 1 | 3 |
| β-strand | 59-68 | 10 | 2 |
| β-strand | 73-79 | 7 | 2 |
| β-strand | 90 | 1 | 3 |
| β-strand | 99-101 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 4 |
| α-helix | 3-5 | 3 | |
| β-strand | 6-10 | 5 | 5 |
| β-strand | 14-19 | 6 | 5 |
| β-strand | 24-31 | 8 | 4 |
| β-strand | 35-42 | 8 | 4 |
| β-strand | 47-54 | 8 | 4 |
| β-strand | 55 | 1 | 6 |
| β-strand | 59-68 | 10 | 5 |
| β-strand | 73-79 | 7 | 5 |
| β-strand | 90 | 1 | 6 |
| β-strand | 99-101 | 3 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prostaglandin E synthase 3 | A, B | protein | 125 | Homo sapiens | Q15185 (AlphaFold model) |
>1EJF_1 Prostaglandin E synthase 3 (chains A, B) MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF DRFSE
Crystal structure and activity of human p23, a heat shock protein 90 co-chaperone. Weaver, A.J., Sullivan, W.P., Felts, S.J. et al. J Biol Chem (2000) 275:23045-23052. DOI 10.1074/jbc.M003410200 · PubMed
Other PDB entries of the same protein (UniProt Q15185 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EJF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.