7KRJ: Heat shock protein HSP 90-alpha

Name: PDB 7KRJ: The GR-Maturation Complex: Glucocorticoid Receptor in complex with Hsp90 and co-chaperone p23
Published: 2022-01-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

The GR-Maturation Complex: Glucocorticoid Receptor in complex with Hsp90 and co-chaperone p23. Determined by electron microscopy at 2.56 Å resolution. Released 12 Jan 2022.

Method: Electron microscopy
Resolution: 2.56 Å
Organism: Homo sapiens
Chains: 4
Atoms: 13,459
Mol. weight: 219.66 kDa
Ligands: DEX, MG, ATP
Released: 12 Jan 2022

Explore 7KRJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KRJ contains 78 α-helices and 73 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	1
β-strand	23	1	2
α-helix	26-35	10
α-helix	43-62	20
α-helix	67-70	4
β-strand	78-83	6	3
β-strand	88-93	6	3
α-helix	100-102	3
α-helix	103-107	5
β-strand	109-110	2	4
α-helix	114-120	7
α-helix	123	1
α-helix	137-143	7
β-strand	148-153	6	3
β-strand	160-164	5	3
β-strand	169-174	6	3
β-strand	183-189	7	3
α-helix	195-198	4
α-helix	200-211	12
β-strand	218-224	7	3
β-strand	284-289	6	3
α-helix	294-295	2
α-helix	301-303	3
α-helix	306-317	12
β-strand	325-331	7	5
β-strand	337-343	7	5
α-helix	347-348	2
β-strand	361-365	5	5
β-strand	368-371	4	5
α-helix	380-382	3
β-strand	386-391	6	5
β-strand	396	1	6
β-strand	403	1	6
α-helix	408-430	23
α-helix	433-451	19
α-helix	456-460	5
β-strand	465	1	7
β-strand	466-467	2	8
β-strand	475	1	7
α-helix	477-482	6
β-strand	490-495	6	8
α-helix	499-503	5
α-helix	506-508	3
α-helix	509-513	5
β-strand	518-521	4	8
α-helix	526-529	4
β-strand	535-536	2	8
β-strand	539-543	5	8
β-strand	546	1	9
α-helix	555-567	13
α-helix	569-578	10
β-strand	586-588	3	9
β-strand	598-601	4	9
α-helix	608-614	7
α-helix	622-624	3
β-strand	632-636	5	9
α-helix	641-652	12
α-helix	657-673	17
α-helix	677-678	2
α-helix	681-695	15

Chain B: 31 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	3
β-strand	23-24	2	4
α-helix	26-36	11
α-helix	41-43	3
α-helix	44-62	19
α-helix	67-70	4
β-strand	78-83	6	1
β-strand	88-93	6	1
α-helix	100-107	8
β-strand	109	1	2
α-helix	114-121	8
α-helix	123	1
α-helix	138-143	6
β-strand	145-153	9	1
β-strand	160-164	5	1
β-strand	169-174	6	1
β-strand	183-190	8	1
α-helix	196-198	3
α-helix	200-211	12
β-strand	218-224	7	1
β-strand	284-289	6	1
α-helix	294-295	2
α-helix	301-303	3
α-helix	306-317	12
β-strand	323-331	9	10
β-strand	337-344	8	10
β-strand	360-365	6	10
β-strand	368-371	4	10
α-helix	380-382	3
β-strand	386-391	6	10
β-strand	396	1	11
β-strand	403	1	11
α-helix	407-427	21
α-helix	431-451	21
α-helix	456-459	4
α-helix	460-462	3
β-strand	465	1	12
β-strand	466-467	2	13
β-strand	475	1	12
α-helix	477-482	6
β-strand	490-495	6	13
α-helix	499-503	5
α-helix	506-508	3
α-helix	509-513	5
β-strand	518-521	4	13
α-helix	526-530	5
β-strand	535-536	2	13
β-strand	539-543	5	13
β-strand	546	1	14
α-helix	555-567	13
α-helix	569-579	11
β-strand	585-588	4	14
β-strand	597-601	5	14
α-helix	608-614	7
α-helix	622-624	3
β-strand	632-636	5	14
α-helix	641-652	12
α-helix	657-673	17
α-helix	676-678	3
α-helix	681-695	15

Chain C: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	15
α-helix	3-5	3
β-strand	6-10	5	16
β-strand	14-19	6	16
β-strand	24-32	9	15
β-strand	35-42	8	15
β-strand	47-54	8	15
β-strand	55	1	17
β-strand	59-68	10	16
β-strand	73-79	7	16
β-strand	90	1	17
α-helix	95-96	2
β-strand	99-101	3	16
α-helix	103-105	3
α-helix	120-130	11

Chain D: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-539	8
α-helix	541-545	5
α-helix	553-554	2
α-helix	556-580	25
α-helix	584-586	3
α-helix	589-613	25
β-strand	621-622	2	18
β-strand	628-629	2	18
α-helix	643-655	13
α-helix	660-671	12
β-strand	674-676	3	19
α-helix	683-702	20
α-helix	708-741	34
α-helix	751-764	14
β-strand	769-771	3	19
α-helix	772	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein HSP 90-alpha	A, B	protein	732	Homo sapiens	P07900 (AlphaFold model)
Prostaglandin E synthase 3	C	protein	160	Homo sapiens	Q15185 (AlphaFold model)
Glucocorticoid receptor	D	protein	258	Homo sapiens	P04150 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7KRJ_1 Heat shock protein HSP 90-alpha (chains A, B)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD

Sequence of entity 2 (C), FASTA

>7KRJ_2 Prostaglandin E synthase 3 (chains C)
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Sequence of entity 3 (D), FASTA

>7KRJ_3 Glucocorticoid receptor (chains D)
IVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAK
AIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCM
YDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGK
AIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITN
QIPKYSNGNIKKLLFHQK

Ligands and cofactors

ID	Name	Formula	Copies
DEX	Dexamethasone	C22 H29 F O5	1
MG	Magnesium ion	Mg	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Primary citation

Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism. Noddings, C.M., Wang, R.Y., Johnson, J.L. et al. Nature (2021) 601:465-469. DOI 10.1038/s41586-021-04236-1 · PubMed

Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TN5 1.17 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
5J80 1.17 Å, Crystal Structure of Apo Hsp90-alpha N-domain L107A mutant
3T0H 1.2 Å, Structure insights into mechanisms of ATP hydrolysis and the activation of human Hsp90
5J2X 1.22 Å, Crystal Structure of Hsp90-alpha N-domain in complex with…
3T10 1.24 Å, HSP90 N-terminal domain bound to ACP
6TN4 1.27 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
3WHA 1.3 Å, Hsp90 alpha N-terminal domain in complex with a tricyclic inhibitor
5XRD 1.3 Å, Crystal Structure of the human Hsp90-alpha N-domain bound to the hsp90 inhibitor FS7
2YK9 1.32 Å, Tricyclic series of Hsp90 inhibitors
5LRL 1.33 Å, Crystal structure of HSP90 in complex with A003492875
6GR5 1.34 Å, Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant…
3B28 1.35 Å, Hsp90 alpha N-terminal domain in complex with an inhibitor CH5015765

Browse structure collections

About this viewer

MolViewer shows 7KRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.