1EK8: Ribosome recycling factor

Crystal structure of the ribosome recycling factor (RRF) from escherichia coli. Determined by X-ray diffraction at 2.3 Å resolution. Released 7 Mar 2001.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,683
Mol. weight: 21.46 kDa
Ligands: HG, DEM
Released: 7 Mar 2001

Explore 1EK8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EK8 contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-25	24
β-strand	41-44	4	1
β-strand	47-50	4	1
α-helix	51-53	3
β-strand	55-61	7	2
β-strand	64-69	6	2
α-helix	72-74	3
α-helix	75-84	10
β-strand	92-94	3	2
β-strand	97-101	5	2
α-helix	103-106	4
α-helix	107-145	39
α-helix	150-182	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosome recycling factor	A	protein	185	Escherichia coli	P0A805 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EK8_1 RIBOSOME RECYCLING FACTOR (chains A)
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVE
DSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGE
AEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEA
ELMQF

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	3
DEM	Decyloxy-methanol	C11 H24 O2	1

Primary citation

Crystal structure of the ribosome recycling factor from Escherichia coli. Kim, K.K., Min, K., Suh, S.W. EMBO J (2000) 19:2362-2370. DOI 10.1093/emboj/19.10.2362 · PubMed

Other PDB entries of the same protein (UniProt P0A805 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ISE 2.2 Å, Crystal structure of a mutant of ribosome recycling factor from Escherichia coli,…
4V9D 3.0 Å, Structures of the bacterial ribosome in classical and hybrid states of tRNA binding
4WOI 3.0 Å, 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting…
4V9C 3.3 Å, Allosteric control of the ribosome by small-molecule antibiotics
1Y69 3.33 Å, RRF domain I in complex with the 50S ribosomal subunit from Deinococcus radiodurans
2RDO 9.1 Å, 50S subunit with EF-G(GDPNP) and RRF bound
1ZN1 14.1 Å, Coordinates of RRF fitted into Cryo-EM map of the 70S post-termination complex
1ZN0 15.5 Å, Coordinates of RRF and EF-G fitted into Cryo-EM map of the 50S subunit bound with both…

Browse structure collections

About this viewer

MolViewer shows 1EK8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.