1EMT: IgG antibody

FAB antibody fragment of an C60 antifullerene antibody. Determined by X-ray diffraction at 2.25 Å resolution. Released 1 Nov 2000.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,515
Mol. weight: 46.46 kDa
Released: 1 Nov 2000

Explore 1EMT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EMT contains 15 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	2
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-52	8	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	65	1	6
β-strand	68-73	6	6
α-helix	74-76	3
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	106	1	2
β-strand	110-114	5	2
α-helix	118-119	2
β-strand	120	1	7
β-strand	123-127	5	8
β-strand	138-148	11	8
β-strand	149	1	7
β-strand	154-157	4	9
β-strand	166-168	3	8
α-helix	169-171	3
β-strand	172-174	3	8
β-strand	177-187	11	8
β-strand	197-202	6	9
α-helix	203-205	3
β-strand	207-212	6	9

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-6	3	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	44-49	6	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	165-167	3
β-strand	173-182	10	4
α-helix	183-188	6
β-strand	191-198	8	5
β-strand	201-210	10	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG antibody (light chain)	L	protein	214	Mus musculus	P01837 (AlphaFold model)
IgG antibody (heavy chain)	H	protein	213	Mus musculus	P01868 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1EMT_1 IGG ANTIBODY (LIGHT CHAIN) (chains L)
DIQMTQTTSSLSASLGDRVTFSCSASQDISNYLNWYQQKPDGTIKLLIYYTSSLRSGVPS
RFSGSGSGTDYSLTINNLEPEDIATYFCQQYSRLPFTFGSGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1EMT_2 IGG ANTIBODY (HEAVY CHAIN) (chains H)
QVHLQESGPELVRPGASVKISCKTSGYVFSSSWMNWVKQRPGQGLKWIGRIYPGNGNTNY
NEKFKGKATLTADKSSNTAYMQLSSLTSVDSAVYFCATSSAYWGQGTLLTVSAAKTTPPS
VYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSS
VTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR

Primary citation

X-ray crystal structure of an anti-Buckminsterfullerene antibody fab fragment: biomolecular recognition of C(60). Braden, B.C., Goldbaum, F.A., Chen, B.X. et al. Proc Natl Acad Sci U S A (2000) 97:12193-12197. DOI 10.1073/pnas.210396197 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1EMT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.