1ERE: Human estrogen receptor ligand-binding domain

Human estrogen receptor ligand-binding domain in complex with 17BETA-estradiol. Determined by X-ray diffraction at 3.1 Å resolution. Released 16 Sept 1998.

Method

X-ray diffraction

Resolution

3.1 Å

Organism

Homo sapiens

Chains

6

Atoms

11,496

Mol. weight

174.97 kDa

Ligands

EST

Released

16 Sept 1998

Explore 1ERE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ERE contains 75 α-helices and 12 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Molecules and chains

>1ERE_1 ESTROGEN RECEPTOR (chains A, B, C, D, E, F)
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPT

Ligands and cofactors

Primary citation

Molecular basis of agonism and antagonism in the oestrogen receptor. Brzozowski, A.M., Pike, A.C., Dauter, Z. et al. Nature (1997) 389:753-758. DOI 10.1038/39645 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P03372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
• 8BZC 1.1 Å, co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244)
• 8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
• 8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
• 7B9R 1.15 Å, Cys-45-tethered stabilizer 4 of 14-3-3(sigma)/ERa PPI
• 7B9T 1.15 Å, Cys-45-tethered stabilizer 5 of 14-3-3(sigma)/ERa PPI
• 7NFW 1.19 Å, Human 14-3-3 sigma in complex with human Estrogen Receptor alpha peptide
• 6HMU 1.2 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C45 mutant bound to…
• 7BA8 1.2 Å, Cys-42-tethered stabilizer 10 of 14-3-3(sigma)/ERa PPI
• 8APS 1.2 Å, Small molecular stabilizer for ERalpha and 14-3-3 (1083744)
• 8BX3 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074372)
• 8BXI 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074361)

Browse more

1ERE is part of these collections:

• Insulin and hormones

About this viewer

MolViewer shows 1ERE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.