1ERW: Thioredoxin

Human thioredoxin double mutant with cys 32 replaced by ser and cys 35 replaced by ser. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Oct 1996.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 875
Mol. weight: 11.72 kDa
Released: 14 Oct 1996

Explore 1ERW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ERW contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
α-helix	5	1
α-helix	8-17	10
β-strand	22-28	7	1
α-helix	33-48	16
β-strand	52-58	7	1
α-helix	63-68	6
β-strand	76-81	6	1
β-strand	84-90	7	1
α-helix	94-104	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin	A	protein	105	Homo sapiens	P10599 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ERW_1 THIOREDOXIN (chains A)
MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Primary citation

Crystal structures of reduced, oxidized, and mutated human thioredoxins: evidence for a regulatory homodimer. Weichsel, A., Gasdaska, J.R., Powis, G. et al. Structure (1996) 4:735-751. DOI 10.1016/S0969-2126(96)00079-2 · PubMed

Other PDB entries of the same protein (UniProt P10599 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OO4 0.97 Å, Crystal Structure of Human Thioredoxin Mutant
3M9J 1.1 Å, Crystal structure of human thioredoxin C69/73S double mutant, reduced form
2IFQ 1.2 Å, Crystal structure of S-nitroso thioredoxin
2HSH 1.35 Å, Crystal structure of C73S mutant of human thioredoxin-1 oxidized with H2O2
5DQY 1.4 Å, A fully oxidized human thioredoxin
3M9K 1.5 Å, Crystal structure of human thioredoxin C69/73S double-mutant, oxidized form
4OO5 1.54 Å, Crystal Structure of S-nitrosated Human Thioredoxin Mutant
1ERV 1.65 Å, Human thioredoxin mutant with cys 73 replaced by ser (reduced form)
2HXK 1.65 Å, Crystal structure of S-nitroso thioredoxin
1ERT 1.7 Å, Human thioredoxin (reduced form)
2IIY 1.7 Å, Crystal structure of S-nitroso thioredoxin
3KD0 1.7 Å, Human thioredoxin C35S,C62S,C69S,C73S mutant showing cadmium chloride bound to the…

Browse structure collections

About this viewer

MolViewer shows 1ERW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.