1EVS: Human oncostatin M

Name: PDB 1EVS: Crystal structure of human oncostatin M
Published: 2000-09-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Crystal structure of human oncostatin M. Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Sept 2000.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,435
Mol. weight: 21.14 kDa
Released: 13 Sept 2000

Explore 1EVS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EVS contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	10-24	15
α-helix	27-29	3
α-helix	31-37	7
α-helix	43-46	4
α-helix	50-52	3
α-helix	59-64	6
α-helix	67-90	24
α-helix	93-94	2
α-helix	95-97	3
α-helix	98-101	4
α-helix	105-131	27
α-helix	159-185	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oncostatin M	A	protein	187	Homo sapiens	P13725 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EVS_1 ONCOSTATIN M (chains A)
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEE
TLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILG
LRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSV
GRVFSKW

Primary citation

Crystal structure and functional dissection of the cytostatic cytokine oncostatin M. Deller, M.C., Hudson, K.R., Ikemizu, S. et al. Structure (2000) 8:863-874. DOI 10.1016/S0969-2126(00)00176-3 · PubMed

Other PDB entries of the same protein (UniProt P13725 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9VWO 2.45 Å, human OSM in complex with Nb3.30
9VWP 3.03 Å, human OSM in complex with Nb3.43
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region
8V29 3.99 Å, Cryo-EM structure of human type I OSM receptor complex: model for full extracellular…

Browse structure collections

About this viewer

MolViewer shows 1EVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.