1EZC: Enzyme I

Name: PDB 1EZC: Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
Published: 1998-01-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: phosphotransferase

Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures. Determined by solution NMR. Released 7 Jan 1998.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,989
Mol. weight: 28.38 kDa
Released: 7 Jan 1998

Explore 1EZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EZC contains 10 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	1
β-strand	16-18	3	2
α-helix	33-65	33
α-helix	67-81	15
α-helix	83-96	14
α-helix	100-117	18
α-helix	121-141	21
α-helix	149-151	3
β-strand	157-160	4	2
α-helix	165-169	5
β-strand	179-181	3	2
α-helix	189-197	9
α-helix	208-210	3
β-strand	217-220	4	1
β-strand	227-229	3	1
α-helix	233-253	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enzyme I	A	protein	259	Escherichia coli	P08839 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EZC_1 ENZYME I (chains A)
MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK
AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD
EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI
TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDR

Primary citation

Solution structure of the 30 kDa N-terminal domain of enzyme I of the Escherichia coli phosphoenolpyruvate:sugar phosphotransferase system by multidimensional NMR. Garrett, D.S., Seok, Y.J., Liao, D.I. et al. Biochemistry (1997) 36:2517-2530. DOI 10.1021/bi962924y · PubMed

Other PDB entries of the same protein (UniProt P08839 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V9K 1.9 Å, Crystal structure of the hybrid C-terminal domain of enzyme I of the bacterial…
1ZYM 2.5 Å, Amino terminal domain of enzyme I from escherichia coli
2HWG 2.7 Å, Structure of phosphorylated Enzyme I of the phosphoenolpyruvate:sugar phosphotransferase…
6VU0 3.5 Å, Crystal structure of the C-terminal domain of enzyme I of the bacterial…
1EZA Amino terminal domain of enzyme I from escherichia coli NMR, restrained regularized mean…
1EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZD Amino terminal domain of enzyme I from escherichia coli NMR, 16 structures
2EZA Amino terminal domain of enzyme I from escherichia coli, NMR, restrained regularized…
2EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2KX9 Solution Structure of the Enzyme I dimer Using Residual Dipolar Couplings and Small…
2L5H Solution Structure of the H189Q mutant of the Enzyme I dimer Using Residual Dipolar…

Browse structure collections

About this viewer

MolViewer shows 1EZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.