1F3H: Human anti-apoptotic protein survivin

X-ray crystal structure of the human anti-apoptotic protein survivin. Determined by X-ray diffraction at 2.58 Å resolution. Released 6 Dec 2000.

Method: X-ray diffraction
Resolution: 2.58 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,320
Mol. weight: 33.28 kDa
Ligands: ZN
Released: 6 Dec 2000

Explore 1F3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F3H contains 13 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-13	6
α-helix	15-19	5
α-helix	35-39	5
β-strand	43-45	3	1
β-strand	48	1	2
β-strand	51	1	2
β-strand	55-57	3	1
β-strand	63-64	2	1
α-helix	73-80	8
α-helix	86-88	3
α-helix	93-95	3
β-strand	97	1	3
α-helix	98-136	39

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	11-13	3
α-helix	15-20	6
β-strand	43-45	3	4
β-strand	55-57	3	4
β-strand	63-64	2	4
α-helix	73-78	6
α-helix	85-88	4
α-helix	93-95	3
β-strand	97	1	3
α-helix	98-136	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Survivin	A, B	protein	142	Homo sapiens	O15392 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1F3H_1 SURVIVIN (chains A, B)
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDMAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAKKVRRAIEQLAAMD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of the human anti-apoptotic protein survivin reveals a dimeric arrangement. Verdecia, M.A., Huang, H., Dutil, E. et al. Nat Struct Biol (2000) 7:602-608. DOI 10.1038/77929 · PubMed

Other PDB entries of the same protein (UniProt O15392 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QFA 1.4 Å, Crystal structure of a Survivin-Borealin-INCENP core complex
9TPI 1.8 Å, Survivin 1-122 in complex with a molecular tweezer-Histone-H3-peptide conjugate
6YIF 1.81 Å, Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3…
9TPH 2.0 Å, Survivin 1-127 in complex with a molecular tweezer-Histone-H3-peptide conjugate
3UEC 2.18 Å, Crystal structure of human Survivin bound to histone H3 phosphorylated on threonine-3.
2RAW 2.4 Å, Crystal structure of the Borealin-Survivin complex
3UIG 2.4 Å, crystal structure of human Survivin in complex with T3 phosphorylated H3(1-15) peptide
3UIH 2.4 Å, crystal structure of human Survivin in complex with Smac/DIABLO(1-15) peptide
8RUP 2.42 Å, Chromosome Passenger Complex (CPC) localization module in complex with H3.T3p-nucleosome
3UEF 2.45 Å, Crystal structure of human Survivin bound to histone H3 (C2 space group).
7LBO 2.5 Å, Crystal structure of human Survivin bound to histone H3 T3phK4me1 peptide
6YIH 2.55 Å, Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3…

Browse structure collections

About this viewer

MolViewer shows 1F3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.