1F3W: Recombinant rabbit muscle pyruvate kinase

Recombinant rabbit muscle pyruvate kinase. Determined by X-ray diffraction at 3.0 Å resolution. Released 3 Oct 2001.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Oryctolagus cuniculus
Chains: 8
Atoms: 31,728
Mol. weight: 465.32 kDa
Ligands: PYR, MN
Released: 3 Oct 2001

Explore 1F3W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F3W contains 208 α-helices and 216 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G and H: 26 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	17-20	4
α-helix	25-30	6
β-strand	45-49	5	1
α-helix	52-54	3
α-helix	57-66	10
β-strand	70-74	5	1
α-helix	80-95	16
β-strand	108-112	5	1
β-strand	118-119	2	2
β-strand	120	1	3
β-strand	123	1	4
β-strand	133	1	5
β-strand	138-142	5	2
α-helix	145-149	5
β-strand	151	1	4
β-strand	155-157	3	2
β-strand	158	1	3
α-helix	161-165	5
β-strand	172-175	4	2
β-strand	180-186	7	2
β-strand	191-196	6	2
β-strand	200	1	5
β-strand	207-209	3	2
α-helix	222-233	12
β-strand	238-241	4	1
α-helix	247-257	11
α-helix	261-263	3
α-helix	264	1
β-strand	265-270	6	1
α-helix	273-277	5
α-helix	279-285	7
β-strand	288-292	5	1
α-helix	293-299	7
α-helix	302-304	3
α-helix	305-319	15
β-strand	323-326	4	1
α-helix	331-334	4
α-helix	341-353	13
β-strand	357-360	4	1
α-helix	370-386	17
α-helix	390-401	12
α-helix	407-422	16
β-strand	427-430	4	6
α-helix	435-442	8
β-strand	449-453	5	6
α-helix	456-461	6
α-helix	462-464	3
β-strand	468	1	6
β-strand	471-472	2	6
α-helix	476-478	3
α-helix	481-499	19
β-strand	507-512	6	6
β-strand	523-528	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pyruvate kinase	A, B, C, D, E, F, G, H	protein	530	Oryctolagus cuniculus	P11974 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>1F3W_1 PYRUVATE KINASE (chains A, B, C, D, E, F, G, H)
SKSHSEAGSAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVETL
KEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRT
GLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLI
SLQVKQKGPDFLVTEVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVF
ASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEI
PAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML
SGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARASSHSTDLMEAMAMGSVEASY
KCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEA
WAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP

Ligands and cofactors

ID	Name	Formula	Copies
PYR	Pyruvic acid	C3 H4 O3	8
MN	Manganese (II) ion	Mn	8

Water and common crystallization additives (K) are not listed.

Primary citation

Structural and functional linkages between subunit interfaces in mammalian pyruvate kinase. Wooll, J.O., Friesen, R.H., White, M.A. et al. J Mol Biol (2001) 312:525-540. DOI 10.1006/jmbi.2001.4978 · PubMed

Other PDB entries of the same protein (UniProt P11974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2G50 1.65 Å, The location of the allosteric amino acid binding site of muscle pyruvate kinase.
1A49 2.1 Å, Bis MG-ATP-K-oxalate complex of pyruvate kinase
8F6M 2.15 Å, Complex of Rabbit muscle pyruvate kinase with ADP and the phosphonate analogue of PEP…
7R6Y 2.25 Å, E117K mutant pyruvate kinase from rabbit muscle
8F5U 2.3 Å, Rabbit muscle pyruvate kinase in complex with magnesium, potassium and pyruvate
1A5U 2.35 Å, Pyruvate kinase complex with bis MG-ATP-na-oxalate
3N25 2.41 Å, The structure of muscle pyruvate kinase in complex with proline, pyruvate, and Mn2+
8F5T 2.41 Å, Rabbit muscle pyruvate kinase in complex with sodium and magnesium
1AQF 2.7 Å, Pyruvate kinase from rabbit muscle with MG, K, and L-phospholactate
1F3X 2.8 Å, S402P mutant of rabbit muscle pyruvate kinase
1PKN 2.9 Å, Structure of rabbit muscle pyruvate kinase complexed with MN2+, K+, and pyruvate

Browse structure collections

About this viewer

MolViewer shows 1F3W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.