1F54: Apo N-terminal domain of yeast calmodulin

Solution structure of the apo N-terminal domain of yeast calmodulin. Determined by solution NMR. Released 15 Jul 2003.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 598
Mol. weight: 8.55 kDa
Released: 15 Jul 2003

Explore 1F54 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F54 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	26-28	3	1
α-helix	29-39	11
α-helix	45-53	9
β-strand	62-64	3	1
α-helix	65-72	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	77	Saccharomyces cerevisiae	P06787 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1F54_1 CALMODULIN (chains A)
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGN
HQIEFSEFLALMSRQLK

Primary citation

Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication. Ishida, H., Takahashi, K., Nakashima, K. et al. Biochemistry (2000) 39:13660-13668. DOI 10.1021/bi000582x · PubMed

Other PDB entries of the same protein (UniProt P06787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OQQ 2.1 Å, Legionella pneumophila SidJ/Saccharomyces cerevisiae calmodulin complex
1F55 Solution structure of the calcium bound N-terminal domain of yeast calmodulin
1LKJ NMR Structure of Apo Calmodulin from Yeast Saccharomyces cerevisiae
2LHH Solution structure of Ca2+-bound yCaM
2LHI Solution structure of Ca2+/CNA1 peptide-bound yCaM

Browse structure collections

About this viewer

MolViewer shows 1F54 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.