1F5X: Y174 autoinhibited dbl homology domain

NMR structure of the Y174 autoinhibited dbl homology domain. Determined by solution NMR. Released 15 Sept 2000.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,710
Mol. weight: 24.49 kDa
Released: 15 Sept 2000

Explore 1F5X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F5X contains 13 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-10	8
α-helix	24-26	3
α-helix	27-46	20
α-helix	54-57	4
α-helix	63-69	7
α-helix	73-92	20
α-helix	96-98	3
α-helix	99-104	6
α-helix	107-110	4
α-helix	112-133	22
α-helix	135-145	11
α-helix	162-177	16
α-helix	185-203	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho-gef vav	A	protein	208	Mus musculus	P27870 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1F5X_1 RHO-GEF VAV (chains A)
MKGDEIYEDLMRLESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRF
LKPQDMETIFVNIEELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYGRYCSQV
ESASKHLDQVATAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHT
QDATEKENLRLALDAMRDLAQCVNEVKR

Primary citation

Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation. Aghazadeh, B., Lowry, W.E., Huang, X.Y. et al. Cell (2000) 102:625-633. DOI 10.1016/S0092-8674(00)00085-4 · PubMed

Other PDB entries of the same protein (UniProt P27870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GCQ 1.68 Å, Crystal structure of vav and GRB2 SH3 domains
2VRW 1.85 Å, Critical structural role for the PH and C1 domains of the Vav1 exchange factor
1GCP 2.1 Å, Crystal structure of vav SH3 domain
1K1Z Solution structure of N-terminal SH3 domain mutant(P33G) of murine Vav
2KBT Attachment of an NMR-invisible solubility enhancement tag (INSET) using a…

Browse structure collections

About this viewer

MolViewer shows 1F5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.