2KBT: PDB entry 2KBT

Attachment of an NMR-invisible solubility enhancement tag (INSET) using a sortase-mediated protein ligation method. Determined by solution NMR. Released 3 Feb 2009.

Method: Solution NMR
Organisms: Mus musculus, Streptococcus sp. 'group G'
Chains: 1
Atoms: 566
Mol. weight: 15.97 kDa
Released: 3 Feb 2009

Explore 2KBT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KBT contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	786-789	4	1
β-strand	800	1	1
β-strand	808-813	6	1
β-strand	820-825	6	1
β-strand	828-833	6	1
β-strand	837-839	3	1
α-helix	845-847	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene vav,Immunoglobulin G-binding protein G	A	protein	142	Mus musculus, Streptococcus sp. 'group G'	P06654 (AlphaFold model), P27870 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KBT_1 Proto-oncogene vav,Immunoglobulin G-binding protein G (chains A)
GPGTFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEE
DYSEYLPETGGGSGSSMTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWT
YDDATKTFTVTEHSLEHHHHHH

Primary citation

Attachment of an NMR-invisible solubility enhancement tag using a sortase-mediated protein ligation method. Kobashigawa, Y., Kumeta, H., Ogura, K. et al. J Biomol NMR (2009) 43:145-150. DOI 10.1007/s10858-008-9296-5 · PubMed

Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IGD 1.1 Å, The third IgG-binding domain from streptococcal protein G: an analysis by X-ray…
2IGD 1.1 Å, Anisotropic structure of protein G IgG-binding domain III at 1.1 Å resolution
3MP9 1.2 Å, Structure of Streptococcal protein G B1 domain at pH 3.0
6CNE 1.2 Å, Selenomethionine variant (V29SeM) of protein GB1
1PGX 1.66 Å, The 1.66 Å X-ray structure of the B2 immunoglobulin-binding domain of streptococcal…
6L9D 1.73 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S
6L91 1.84 Å, X-ray structure of synthetic GB1 domain with the mutation K10(DVA).
6LJI 1.84 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11V
1PGB 1.92 Å, Two crystal structures of the B1 immunoglobulin-binding domain of streptoccocal protein…
4KGS 1.95 Å, Backbone Modifications in the Protein GB1 Loops: beta-3-Val21, beta-3-Asp40
6L9B 1.95 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11A
1EM7 2.0 Å, Helix variant of the B1 domain from streptococcal protein G

Browse structure collections

About this viewer

MolViewer shows 2KBT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.