Native Influenza Virus Neuraminidase in Complex with NEU5AC2EN. Determined by X-ray diffraction at 1.8 Å resolution. Released 11 Apr 2001.
Explore 1F8B in 3D Show helices and sheets RCSB PDB PDBe
1F8B contains 9 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 89 | 1 | |
| β-strand | 90-91 | 2 | 1 |
| α-helix | 92-93 | 2 | |
| β-strand | 96-102 | 7 | 2 |
| α-helix | 105-108 | 4 | |
| α-helix | 109-111 | 3 | |
| β-strand | 114 | 1 | 3 |
| β-strand | 115 | 1 | 4 |
| α-helix | 116 | 1 | |
| β-strand | 121-124 | 4 | 5 |
| β-strand | 129-135 | 7 | 5 |
| β-strand | 139 | 1 | 4 |
| α-helix | 143-145 | 3 | |
| β-strand | 157-162 | 6 | 5 |
| β-strand | 168 | 1 | 3 |
| β-strand | 172-176 | 5 | 5 |
| β-strand | 179-184 | 6 | 6 |
| β-strand | 189-195 | 7 | 6 |
| β-strand | 202-207 | 6 | 6 |
| β-strand | 210-216 | 7 | 6 |
| β-strand | 224 | 1 | 7 |
| β-strand | 233 | 1 | 7 |
| β-strand | 236-244 | 9 | 7 |
| β-strand | 250-258 | 9 | 7 |
| β-strand | 261-267 | 7 | 7 |
| β-strand | 276-283 | 8 | 8 |
| β-strand | 286-292 | 7 | 8 |
| α-helix | 300 | 1 | |
| β-strand | 301-306 | 6 | 8 |
| β-strand | 311-316 | 6 | 8 |
| α-helix | 340-342 | 3 | |
| β-strand | 353-354 | 2 | 9 |
| β-strand | 361-364 | 4 | 9 |
| β-strand | 372-378 | 7 | 9 |
| β-strand | 392-403 | 11 | 9 |
| β-strand | 407-410 | 4 | 2 |
| β-strand | 417-418 | 2 | 1 |
| β-strand | 421-429 | 9 | 2 |
| β-strand | 439-449 | 11 | 2 |
| α-helix | 464-467 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuraminidase | A | protein | 388 | Influenza A virus (A/tern/Australia/G70C/1975(H11N9)) | P03472 |
>1F8B_1 NEURAMINIDASE (chains A) RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPYVSCDPDECRFYALSQGTTIR GKHSNGTIHDRSQYRALISWPLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVVFTDGSATGPAETRIYYFKEG KILKWEPLAGTAKHIEECSCYGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTWLGRTISIASRSGYEMLKVPN ALTDDKSKPTQGQTIVLNTDWSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS NSIVSMCSSTEFLGQWDWPDGAKIEYFL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| CA | Calcium ion | Ca | 2 |
| DAN | 2-deoxy-2,3-dehydro-N-acetyl-neuraminic acid | C11 H17 N O8 | 1 |
Analysis of inhibitor binding in influenza virus neuraminidase. Smith, B.J., Colman, P.M., Von Itzstein, M. et al. Protein Sci (2001) 10:689-696. DOI 10.1110/ps.41801 · PubMed
Other PDB entries of the same protein (UniProt P03472), best resolution first:
MolViewer shows 1F8B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.