6HEB: Neuraminidase

Influenza A Virus N9 Neuraminidase complex with Oseltamivir (Tern). Determined by X-ray diffraction at 1.75 Å resolution. Released 29 Aug 2018.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9)
Chains: 1
Atoms: 4,005
Mol. weight: 47.05 kDa
Ligands: CA, G39
Released: 29 Aug 2018

Explore 6HEB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HEB contains 8 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	92	1	1
α-helix	93-94	2
β-strand	97-103	7	2
α-helix	106-110	5
β-strand	115	1	3
β-strand	116-126	11	4
β-strand	129-140	12	4
α-helix	144-146	3
β-strand	158-163	6	4
β-strand	169	1	3
α-helix	173	1
β-strand	174-178	5	4
β-strand	181-186	6	5
β-strand	191-197	7	5
β-strand	204-209	6	5
β-strand	212-218	7	5
β-strand	226	1	6
β-strand	235	1	7
β-strand	238	1	7
β-strand	239-246	8	6
β-strand	252-260	9	6
β-strand	263-269	7	6
β-strand	278-285	8	8
β-strand	288-294	7	8
α-helix	302	1
β-strand	303-308	6	8
β-strand	313-318	6	8
α-helix	330-332	3
β-strand	354-355	2	9
β-strand	362-365	4	9
β-strand	373-379	7	9
β-strand	393-403	11	9
β-strand	407-411	5	2
β-strand	420	1	1
β-strand	422-431	10	2
β-strand	441-451	11	2
α-helix	455-457	3
α-helix	466-469	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuraminidase	A	protein	388	Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9)	P03472

Sequence of entity 1 (A), FASTA

>6HEB_1 Neuraminidase (chains A)
RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPYVSCDPDECRFYALSQGTTIR
GKHSNGTIHDRSQYRALISWPLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN
ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVVFTDGSATGPAETRIYYFKEG
KILKWEPLAGTAKHIEECSCYGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP
VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTWLGRTISIASRSGYEMLKVPN
ALTDDKSKPTQGQTIVLNTDWSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS
NSIVSMCSSTEFLGQWDWPDGAKIEYFL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
G39	(3R,4R,5S)-4-(acetylamino)-5-amino-3-(pentan-3-yloxy)cyclohex-1-ene-1-carboxyli…	C14 H24 N2 O4	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

High Resolution Structures of Viral Neuraminidase with Drugs Bound in the Active Site. Salinger, M.T., Hobbs, J.R., Murray, J.W. et al. To be published.

Other PDB entries of the same protein (UniProt P03472), best resolution first:

6HFC 1.29 Å, Influenza A Virus N9 Neuraminidase Native (Tern).
6HCX 1.3 Å, Influenza Virus N9 Neuraminidase A complex with Zanamivir molecule (Tern).
6HG0 1.3 Å, Influenza A Virus N9 Neuraminidase complex with NANA (Tern/Australia).
1F8D 1.4 Å, Native Influenza Neuraminidase in Complex with 9-amino-2-deoxy-2,3-dehydro-N-neuraminic…
1F8E 1.4 Å, Native Influenza Neuraminidase in Complex with 4,9-diamino-2-deoxy-2,3-dehydro-N-acetyl-n…
6D3B 1.4 Å, Influenza virus neuraminidase subtype N9 (TERN) apo form
4DGR 1.55 Å, Influenza Subtype 9 Neuraminidase Benzoic Acid Inhibitor Complex
2QWC 1.6 Å, The X-ray structure of a complex of NEU5AC2EN and a drug resistant variant R292K of tern…
1F8C 1.7 Å, Native Influenza Neuraminidase in Complex with 4-amino-2-deoxy-2,3-dehydro-N-neuraminic…
1MWE 1.7 Å, The X-ray structure of a complex of tern N9 influenza virus neuraminidase complexed with…
2QWA 1.7 Å, The X-ray structure of a drug resistant variant R292K of tern N9 influenza virus…
1F8B 1.8 Å, Native Influenza Virus Neuraminidase in Complex with NEU5AC2EN

Browse structure collections

About this viewer

MolViewer shows 6HEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.