Solution structure of myb-domain of human RAP1. Determined by solution NMR. Released 19 Sept 2001.
Explore 1FEX in 3D Show helices and sheets RCSB PDB PDBe
1FEX contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-19 | 13 | |
| α-helix | 31-38 | 8 | |
| α-helix | 47-56 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TRF2-interacting telomeric RAP1 protein | A | protein | 59 | Q9NYB0 (AlphaFold model) |
>1FEX_1 TRF2-INTERACTING TELOMERIC RAP1 PROTEIN (chains A) GRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRG
NMR structure of the hRap1 Myb motif reveals a canonical three-helix bundle lacking the positive surface charge typical of Myb DNA-binding domains. Hanaoka, S., Nagadoi, A., Yoshimura, S. et al. J Mol Biol (2001) 312:167-175. DOI 10.1006/jmbi.2001.4924 · PubMed
Other PDB entries of the same protein (UniProt Q9NYB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FEX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.