4RQI: TRF2/RAP1 secondary interaction binding site
Structure of TRF2/RAP1 secondary interaction binding site. Determined by X-ray diffraction at 2.44 Å resolution. Released 10 Feb 2016.
- Method
- X-ray diffraction
- Resolution
- 2.44 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 7,031
- Mol. weight
- 103.19 kDa
- Ligands
- MG
- Released
- 10 Feb 2016
Explore 4RQI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4RQI contains 48 α-helices and 2 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 46-69 | 24 | |
| α-helix | 73-86 | 14 | |
| α-helix | 95-111 | 17 | |
| α-helix | 128-142 | 15 | |
| α-helix | 147-167 | 21 | |
| α-helix | 171-182 | 12 | |
| α-helix | 186-188 | 3 | |
| α-helix | 189-201 | 13 | |
| α-helix | 207-210 | 4 | |
| α-helix | 214-226 | 13 | |
| α-helix | 232-234 | 3 | |
| α-helix | 235-244 | 10 | |
Chain B: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 47-69 | 23 | |
| α-helix | 73-86 | 14 | |
| α-helix | 95-111 | 17 | |
| α-helix | 128-142 | 15 | |
| α-helix | 147-167 | 21 | |
| α-helix | 171-177 | 7 | |
| α-helix | 178-182 | 5 | |
| α-helix | 189-201 | 13 | |
| α-helix | 207-210 | 4 | |
| α-helix | 214-226 | 13 | |
| α-helix | 232-234 | 3 | |
| α-helix | 235-244 | 10 | |
Chain C: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 45-69 | 25 | |
| α-helix | 73-86 | 14 | |
| α-helix | 95-111 | 17 | |
| α-helix | 128-142 | 15 | |
| α-helix | 147-167 | 21 | |
| α-helix | 171-182 | 12 | |
| α-helix | 189-201 | 13 | |
| α-helix | 207-210 | 4 | |
| α-helix | 214-226 | 13 | |
| α-helix | 231-234 | 4 | |
| α-helix | 235-241 | 7 | |
Chain D: 11 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 45-69 | 25 | |
| α-helix | 73-86 | 14 | |
| α-helix | 96-111 | 16 | |
| β-strand | 119 | 1 | 1 |
| α-helix | 128-142 | 15 | |
| α-helix | 147-167 | 21 | |
| α-helix | 171-179 | 9 | |
| α-helix | 189-201 | 13 | |
| α-helix | 207-210 | 4 | |
| α-helix | 214-226 | 13 | |
| α-helix | 232-234 | 3 | |
| α-helix | 235-244 | 10 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 93-97 | 5 | |
Chain H: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 97-99 | 3 | |
| β-strand | 105 | 1 | 1 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Telomeric repeat-binding factor 2 | A, B, C, D | protein | 203 | Homo sapiens | Q15554 (AlphaFold model) |
| Telomeric repeat-binding factor 2-interacting protein 1 | E, F, G, H | protein | 18 | Homo sapiens | Q9NYB0 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>4RQI_1 Telomeric repeat-binding factor 2 (chains A, B, C, D)
AGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLR
VMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAV
IICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKML
RFLESHLDDAEPYLLTMAKKALK
Sequence of entity 2 (E, F, G, H), FASTA
>4RQI_2 Telomeric repeat-binding factor 2-interacting protein 1 (chains E, F, G, H)
ENRERLELEAYRLGPASA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (GOL) are not listed.
Primary citation
A higher-order entity formed by the flexible assembly of RAP1 with TRF2. Gaullier, G., Miron, S., Pisano, S. et al. Nucleic Acids Res (2016) 44:1962-1976. DOI 10.1093/nar/gkv1531 · PubMed
Other PDB entries of the same protein (UniProt Q15554 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3SJM 1.35 Å, Crystal Structure Analysis of TRF2-Dbd-DNA complex
- 1W0U 1.8 Å, hTRF2 DNA-binding domain in complex with telomeric DNA.
- 3K6G 1.95 Å, Crystal structure of Rap1 and TRF2 complex
- 4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
- 6J67 2.05 Å, Crystal structure of the compound 34 in a complex with TRF2
- 3BU8 2.15 Å, Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
- 7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
- 1H6P 2.2 Å, Dimeristion domain from human TRF2
- 5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
- 3BUA 2.5 Å, Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
- 9Q9K 2.59 Å, Cryo-EM structure of human Mre11-Rad50 (MR) complex bound to DNA and telomeric factor…
- 9Q9J 2.71 Å, Cryo-EM structure of human Mre11-Rad50-Nbs1 (MRN) complex bound to DNA and telomeric…
Browse structure collections
About this viewer
MolViewer shows 4RQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.