1FI8: Natural killer cell protease 1

Rat granzyme B [N66Q] complexed to ecotin [81-84 iepd]. Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Sept 2000.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Rattus norvegicus, Escherichia coli
Chains: 6
Atoms: 5,638
Mol. weight: 82.8 kDa
Released: 13 Sept 2000

Explore 1FI8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FI8 contains 31 α-helices and 70 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-36	7	3
β-strand	41-48	8	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-68	6	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	95	1	5
β-strand	100	1	5
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	122-125	4
β-strand	135-140	6	2
β-strand	143	1	6
α-helix	149	1
β-strand	151	1	6
α-helix	152	1
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	165-171A	7
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	204-217	10	2
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-242	8

Chain B: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	11
β-strand	20-21	2	12
α-helix	22-23	2
β-strand	30-36	7	13
β-strand	39-48	10	13
β-strand	51-54	4	13
α-helix	56-58	3
β-strand	64-68	6	13
β-strand	72	1	14
β-strand	81-90	10	13
β-strand	95	1	15
β-strand	100	1	15
β-strand	104-108	5	13
α-helix	111-114	4
α-helix	122-125	4
β-strand	135-140	6	12
β-strand	143	1	16
α-helix	149	1
β-strand	151	1	16
α-helix	152	1
β-strand	154	1	14
β-strand	156-162	7	12
α-helix	165-171A	7
β-strand	180-183	4	12
β-strand	189	1	11
β-strand	198-201	4	12
β-strand	204-217	10	12
β-strand	226-230	5	12
α-helix	231-234	4
α-helix	235-242	8

Chain C: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	13-17	5
β-strand	20-25	6	7
α-helix	27-29	3
α-helix	33-35	3
β-strand	36-45	10	8
β-strand	54	1	2
β-strand	55	1	9
β-strand	58-64	7	7
β-strand	69-75	7	7
α-helix	80	1
β-strand	81-83	3	2

Chain D: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	96-98	3	8
β-strand	99	1	9
α-helix	102-105	4
β-strand	106-108	3	8
β-strand	115-120	6	7
β-strand	124-132	9	8
β-strand	137-138	2	8
α-helix	139	1
β-strand	140-141	2	10

Chain E: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	13-17	5
β-strand	20-25	6	10
α-helix	27-29	3
α-helix	33-35	3
β-strand	36-45	10	8
β-strand	54	1	12
β-strand	55	1	17
β-strand	59-64	6	10
β-strand	69-74	6	10
α-helix	79-80	2
β-strand	81-83	3	12

Chain F: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	96-98	3	8
β-strand	99	1	17
α-helix	102-105	4
β-strand	106-108	3	8
β-strand	115-120	6	10
β-strand	124-132	9	8
β-strand	137-138	2	8
β-strand	140-141	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Natural killer cell protease 1	A, B	protein	228	Rattus norvegicus	P18291 (AlphaFold model)
Ecotin	C, E	protein	84	Escherichia coli	P23827 (AlphaFold model)
Ecotin	D, F	protein	58	Escherichia coli	P23827 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1FI8_1 NATURAL KILLER CELL PROTEASE 1 (chains A, B)
IIGGHEAKPHSRPYMAYLQIMDEYSGSKKCGGFLIREDFVLTAAHCSGSKIQVTLGAHNI
KEQEKMQQIIPVVKIIPHPAYNSKTISNDIMLLKLKSKAKRSSAVKPLNLPRRNVKVKPG
DVCYVAGWGKLGPMGKYSDTLQEVELTVQEDQKCESYLKNYFDKANEICAGDPKIKRASF
RGDSGGPLVCKKVAAGIVSYGQNDGSTPRAFTKVSTFLSWIKKTMKKS

Sequence of entity 2 (C, E), FASTA

>1FI8_2 ECOTIN (chains C, E)
AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLE
NKTLEGWGYDYYVFDKVSSPIEPD

Sequence of entity 3 (D, F), FASTA

>1FI8_3 ECOTIN (chains D, F)
MACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR

Primary citation

The structure of the pro-apoptotic protease granzyme B reveals the molecular determinants of its specificity. Waugh, S.M., Harris, J.L., Fletterick, R. et al. Nat Struct Biol (2000) 7:762-765. DOI 10.1038/78992 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1FI8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.