1FJ1: Lyme disease antigen ospa

Lyme disease antigen ospa in complex with neutralizing antibody FAB la-2. Determined by X-ray diffraction at 2.68 Å resolution. Released 11 Oct 2000.

Method: X-ray diffraction
Resolution: 2.68 Å
Organisms: Mus musculus, Borrelia burgdorferi
Chains: 6
Atoms: 10,542
Mol. weight: 147.84 kDa
Released: 11 Oct 2000

Explore 1FJ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FJ1 contains 25 α-helices and 135 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	165-167	3
β-strand	173-182	10	4
α-helix	183-187	5
β-strand	191-197	7	5
α-helix	204	1
β-strand	205-210	6	5

Chain B: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	35-39	5	7
β-strand	45-51	7	7
β-strand	58-60	3	7
α-helix	62-64	3
β-strand	68-73	6	6
α-helix	74-76	3
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-98	7	7
β-strand	102-103	2	7
β-strand	107-111	5	7
β-strand	117	1	8
α-helix	118-119	2
β-strand	120-124	5	9
β-strand	135-145	11	9
β-strand	146	1	8
β-strand	151-155	5	10
β-strand	162-171	10	9
β-strand	174-184	11	9
β-strand	194-199	6	10
α-helix	200-202	3
β-strand	204-209	6	10

Chain C: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	10-14	5	12
β-strand	19-25	7	11
β-strand	33-38	6	12
β-strand	45-49	5	12
β-strand	53-54	2	12
α-helix	55	1
β-strand	62-67	6	11
β-strand	70-75	6	11
α-helix	80-82	3
β-strand	84-90	7	12
β-strand	97-98	2	12
β-strand	102-107	6	12
β-strand	111	1	13
β-strand	114-118	5	14
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	14
β-strand	140	1	13
β-strand	145-150	6	15
β-strand	153-155	3	15
β-strand	159-163	5	14
α-helix	165-167	3
β-strand	173-182	10	14
α-helix	183-187	5
β-strand	191-197	7	15
β-strand	205-210	6	15

Chain D: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	16
β-strand	10-12	3	17
β-strand	18-25	8	16
α-helix	29-31	3
β-strand	35-39	5	17
β-strand	46-51	6	17
β-strand	58-60	3	17
α-helix	62-64	3
β-strand	68-73	6	16
α-helix	74-76	3
β-strand	78-83	6	16
α-helix	88-90	3
β-strand	92-98	7	17
β-strand	102-103	2	17
β-strand	107-111	5	17
β-strand	117	1	18
β-strand	120-124	5	19
β-strand	133	1	19
β-strand	135-145	11	19
β-strand	146	1	18
β-strand	151-155	5	20
β-strand	163-171	9	19
β-strand	174-184	11	19
β-strand	194-199	6	20
β-strand	204-209	6	20

Chains E and F: 1 helix, 26 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	21
β-strand	38-41	4	21
β-strand	54	1	22
β-strand	55	1	21
β-strand	65	1	22
β-strand	75-76	2	23
β-strand	79	1	24
β-strand	85	1	24
β-strand	87-89	3	23
β-strand	98-102	5	23
β-strand	109-115	7	23
β-strand	121-126	6	23
β-strand	132-138	7	23
β-strand	144-148	5	23
β-strand	156-162	7	23
β-strand	165-171	7	23
β-strand	175-182	8	23
β-strand	185-192	8	23
β-strand	197-203	7	23
β-strand	212-217	6	25
β-strand	222-227	6	25
β-strand	230-237	8	25
β-strand	243-247	5	25
β-strand	248	1	26
β-strand	255	1	26
β-strand	260-261	2	25
α-helix	265-271	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hybridoma antibody LA2 (light chain)	A, C	protein	213	Mus musculus	P01837 (AlphaFold model)
Hybridoma antibody LA2 (heavy chain)	B, D	protein	213	Mus musculus	P01867 (AlphaFold model)
Outer surface protein A	E, F	protein	257	Borrelia burgdorferi	P0CL66 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1FJ1_1 HYBRIDOMA ANTIBODY LA2 (LIGHT CHAIN) (chains A, C)
DIQMTQSPSSLSATLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGNPS
RFSGSGSGRDYSFSISNLEAEDIAIYYCLQYDNLQRTFGGGTKVEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE

Sequence of entity 2 (B, D), FASTA

>1FJ1_2 HYBRIDOMA ANTIBODY LA2 (HEAVY CHAIN) (chains B, D)
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSMYWVKQAPGKGLKRMGWINTETGEPTY
ADDFKGRFALSLDTSASTAYLHISNLKNEDTATYFCARGLDSWGQGTSVTVSSAKTTPPS
VYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSS
VTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS

Sequence of entity 3 (E, F), FASTA

>1FJ1_3 OUTER SURFACE PROTEIN A (chains E, F)
AKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVL
EGVKADKCKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKI
ITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGE
VSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLE
GSAVEITKLDEIKNALK

Primary citation

Structural identification of a key protective B-cell epitope in Lyme disease antigen OspA. Ding, W., Huang, X., Yang, X. et al. J Mol Biol (2000) 302:1153-1164. DOI 10.1006/jmbi.2000.4119 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1FJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.