1FKK: FK506 binding protein

Atomic structure of FKBP12, an immunophilin binding protein. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Dec 1995.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Bos taurus
Chains: 1
Atoms: 902
Mol. weight: 11.89 kDa
Released: 7 Dec 1995

Explore 1FKK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FKK contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	20	1
β-strand	21-30	10	1
β-strand	35-38	4	1
β-strand	46-49	4	1
α-helix	57-63	7
β-strand	71-76	6	1
α-helix	78-80	3
β-strand	87	1	2
β-strand	91	1	2
β-strand	97-106	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FK506 binding protein	A	protein	107	Bos taurus	P18203 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FKK_1 FK506 BINDING PROTEIN (chains A)
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWE
EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE

Primary citation

Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin. Wilson, K.P., Yamashita, M.M., Sintchak, M.D. et al. Acta Crystallogr D Biol Crystallogr (1995) 51:511-521. DOI 10.1107/S0907444994014514 · PubMed

Other PDB entries of the same protein (UniProt P18203 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FKL 1.7 Å, Atomic structure of FKBP12-rapaymycin, an immunophilin-immunosuppressant complex
1TCO 2.5 Å, Ternary complex of a calcineurin a fragment, calcineurin B, FKBP12 and the…

Browse structure collections

About this viewer

MolViewer shows 1FKK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.