Atomic structure of FKBP12-rapaymycin, an immunophilin-immunosuppressant complex. Determined by X-ray diffraction at 1.7 Å resolution. Released 7 Dec 1995.
Explore 1FKL in 3D Show helices and sheets RCSB PDB PDBe
1FKL contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| α-helix | 20 | 1 | |
| β-strand | 21-30 | 10 | 1 |
| β-strand | 35-38 | 4 | 1 |
| α-helix | 40-42 | 3 | |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 57-64 | 8 | |
| β-strand | 71-76 | 6 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 91 | 1 | 2 |
| β-strand | 97-106 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FK506 binding protein | A | protein | 107 | Bos taurus | P18203 (AlphaFold model) |
>1FKL_1 FK506 BINDING PROTEIN (chains A) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWE EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
| ID | Name | Formula | Copies |
|---|---|---|---|
| RAP | Rapamycin immunosuppressant drug | C51 H79 N O13 | 1 |
Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin. Wilson, K.P., Yamashita, M.M., Sintchak, M.D. et al. Acta Crystallogr D Biol Crystallogr (1995) 51:511-521. DOI 10.1107/S0907444994014514 · PubMed
Other PDB entries of the same protein (UniProt P18203 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FKL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.