1FLL: Tnf receptor associated factor 3

Molecular basis for CD40 signaling mediated by TRAF3. Determined by X-ray diffraction at 3.5 Å resolution. Released 18 Oct 2000.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,558
Mol. weight: 56.16 kDa
Released: 18 Oct 2000

Explore 1FLL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FLL contains 11 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	304-307	4
α-helix	308-310	3
α-helix	314-345	32
β-strand	350	1	1
β-strand	353-359	7	2
α-helix	361-364	4
β-strand	376-377	2	3
β-strand	382	1	1
β-strand	392-395	4	3
β-strand	407-411	5	3
β-strand	431-435	5	2
β-strand	444-446	3	2
β-strand	470-474	5	3
α-helix	476-479	4
β-strand	486	1	2
β-strand	489-495	7	2

Chain B: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	302-304	3
α-helix	311-328	18
α-helix	331-345	15
β-strand	350	1	4
β-strand	355-359	5	5
α-helix	361-370	10
β-strand	376-377	2	6
β-strand	382	1	4
β-strand	389-390	2	4
β-strand	393-395	3	6
β-strand	406	1	7
β-strand	408-409	2	6
β-strand	413-414	2	4
α-helix	419-421	3
β-strand	431-435	5	5
β-strand	444-447	4	5
β-strand	464	1	4
β-strand	470	1	6
β-strand	475	1	7
α-helix	476-480	5
β-strand	486	1	5
β-strand	489-493	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tnf receptor associated factor 3	A, B	protein	228	Homo sapiens	Q13114 (AlphaFold model)
B-cell surface antigen CD40	X, Y	protein	21		P25942 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1FLL_1 TNF RECEPTOR ASSOCIATED FACTOR 3 (chains A, B)
RQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLA
DMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYL
NGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS
FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP

Sequence of entity 2 (X, Y), FASTA

>1FLL_2 B-CELL SURFACE ANTIGEN CD40 (chains X, Y)
KTAAPVQETLHGSQPVTQEDG

Primary citation

Molecular basis for CD40 signaling mediated by TRAF3. Ni, C.Z., Welsh, K., Leo, E. et al. Proc Natl Acad Sci U S A (2000) 97:10395-10399. DOI 10.1073/pnas.97.19.10395 · PubMed

Other PDB entries of the same protein (UniProt Q13114 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T5P 2.5 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF3 TRAF domain
2GKW 2.7 Å, Key contacts promote recongnito of BAFF-R by TRAF3
1FLK 2.8 Å, Molecular basis for CD40 signaling mediated by TRAF3
1ZMS 2.8 Å, LMP1 Protein binds to TRAF3 as a structural CD40
8ZUK 2.83 Å, Cluster structure of the BAFF-BAFFR-TRAF3 complex
1L0A 2.9 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1KZZ 3.5 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1RF3 3.5 Å, Structurally Distinct Recognition Motifs in Lymphotoxin-B Receptor and CD40 for…
2ECY Solution structure of the Zinc finger, C3HC4 type (RING finger)" domain of TNF…

Browse structure collections

About this viewer

MolViewer shows 1FLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.