1FNL: Extracellular domain of a human fcgriii

Crystal structure of the extracellular domain of a human fcgriii. Determined by X-ray diffraction at 1.8 Å resolution. Released 22 Nov 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,616
Mol. weight: 20.41 kDa
Ligands: HG
Released: 22 Nov 2000

Explore 1FNL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FNL contains 6 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
β-strand	9-13	5	1
β-strand	18-20	3	2
β-strand	25-30	6	1
β-strand	34	1	3
β-strand	37	1	3
β-strand	41-44	4	4
β-strand	47-50	4	4
β-strand	55-58	4	1
α-helix	63-65	3
β-strand	67-72	6	4
α-helix	79-81	3
β-strand	82-84	3	4
β-strand	85-87	3	2
β-strand	91-94	4	5
β-strand	99-101	3	6
β-strand	106-108	3	7
β-strand	109-112	4	5
α-helix	113	1
β-strand	119-125	7	8
β-strand	128-135	8	8
β-strand	139-141	3	7
α-helix	146-148	3
β-strand	150-158	9	8
β-strand	161-164	4	8
α-helix	165-167	3
β-strand	168-170	3	8
β-strand	171-173	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low affinity immunoglobulin gamma fc region receptor III-B	A	protein	175	Homo sapiens	O75015 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FNL_1 LOW AFFINITY IMMUNOGLOBULIN GAMMA FC REGION RECEPTOR III-B (chains A)
RTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDA
ATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHK
VTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQA

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	2

Primary citation

Crystal structure of the extracellular domain of a human Fc gamma RIII. Zhang, Y., Boesen, C.C., Radaev, S. et al. Immunity (2000) 13:387-395. DOI 10.1016/S1074-7613(00)00038-8 · PubMed

Other PDB entries of the same protein (UniProt O75015 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EAQ 2.22 Å, Glycosylated FCGR3B / CD16b in complex with afucosylated IgG1 Fc
1E4J 2.5 Å, Crystal structure of the soluble human Fc-gamma Receptor III
1T83 3.0 Å, Crystal structure of a human type III fc gamma receptor in complex with an fc fragment…
1E4K 3.2 Å, Crystal structure of soluble human IgG1 fc fragment-fc-gamma receptor III complex
1T89 3.5 Å, Crystal structure of a human type III fc gamma receptor in complex with an fc fragment…

Browse structure collections

About this viewer

MolViewer shows 1FNL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.