1FQI: RGS9 rgs domain

RGS9 rgs domain. Determined by X-ray diffraction at 1.94 Å resolution. Released 28 Feb 2001.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Bos taurus
Chains: 1
Atoms: 1,281
Mol. weight: 17.65 kDa
Released: 28 Feb 2001

Explore 1FQI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FQI contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	290-295	6
α-helix	300-304	5
α-helix	307-319	13
α-helix	324-336	13
α-helix	340-342	3
α-helix	343-350	8
α-helix	351-355	5
α-helix	367-376	10
α-helix	386-396	11
α-helix	397-401	5
α-helix	402-405	4
α-helix	408-416	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of G-protein signaling 9	A	protein	147	Bos taurus	O46469 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FQI_1 REGULATOR OF G-PROTEIN SIGNALING 9 (chains A)
QFWDLNAKLVDIPTKMRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDL
KYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYML
MKKDSYARYLKSPIYKEMLAKAIEPQG

Primary citation

Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A. Slep, K.C., Kercher, M.A., He, W. et al. Nature (2001) 409:1071-1077. DOI 10.1038/35059138 · PubMed

Other PDB entries of the same protein (UniProt O46469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FQJ 2.02 Å, Crystal structure of the heterotrimeric complex of the rgs domain of RGS9, the gamma…
1FQK 2.3 Å, Crystal structure of the heterodimeric complex of the rgs domain of RGS9, and the GT/I1…

Browse structure collections

About this viewer

MolViewer shows 1FQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.