1FQJ: PDB entry 1FQJ
Crystal structure of the heterotrimeric complex of the rgs domain of RGS9, the gamma subunit of phosphodiesterase and the GT/I1 chimera alpha subunit [(RGS9)-(pdegamma)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)]. Determined by X-ray diffraction at 2.02 Å resolution. Released 28 Feb 2001.
- Method
- X-ray diffraction
- Resolution
- 2.02 Å
- Organisms
- Bos taurus, Rattus norvegicus
- Chains
- 5
- Atoms
- 8,107
- Mol. weight
- 115.26 kDa
- Ligands
- MG, ALF, GDP
- Released
- 28 Feb 2001
Explore 1FQJ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1FQJ contains 66 α-helices and 16 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 19 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 29-36 | 8 | 1 |
| α-helix | 42-53 | 12 | |
| α-helix | 59-63 | 5 | |
| α-helix | 66-86 | 21 | |
| α-helix | 95-109 | 15 | |
| α-helix | 111 | 1 | |
| α-helix | 117-127 | 11 | |
| α-helix | 130-136 | 7 | |
| α-helix | 139-141 | 3 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-158 | 4 | |
| α-helix | 167-171 | 5 | |
| β-strand | 180-187 | 8 | 1 |
| β-strand | 190-197 | 8 | 1 |
| α-helix | 201-210 | 10 | |
| β-strand | 216-222 | 7 | 1 |
| α-helix | 223-227 | 5 | |
| β-strand | 229 | 1 | 2 |
| β-strand | 237 | 1 | 2 |
| α-helix | 238-250 | 13 | |
| α-helix | 253-255 | 3 | |
| β-strand | 259-265 | 7 | 1 |
| α-helix | 267-273 | 7 | |
| α-helix | 279-281 | 3 | |
| α-helix | 292-304 | 13 | |
| β-strand | 316-319 | 4 | 1 |
| α-helix | 325-342 | 18 | |
Chain B: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 290-295 | 6 | |
| α-helix | 300-304 | 5 | |
| α-helix | 307-319 | 13 | |
| α-helix | 324-337 | 14 | |
| α-helix | 343-350 | 8 | |
| α-helix | 351-355 | 5 | |
| α-helix | 367-376 | 10 | |
| α-helix | 386-395 | 10 | |
| α-helix | 396-400 | 5 | |
| α-helix | 401-406 | 6 | |
| α-helix | 408-415 | 8 | |
Chain C: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62 | 1 | |
| α-helix | 63-67 | 5 | |
| α-helix | 69-73 | 5 | |
| α-helix | 78-83 | 6 | |
Chain D: 19 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 29-36 | 8 | 3 |
| α-helix | 42-52 | 11 | |
| α-helix | 59-63 | 5 | |
| α-helix | 65-86 | 22 | |
| α-helix | 95-107 | 13 | |
| α-helix | 111 | 1 | |
| α-helix | 117-127 | 11 | |
| α-helix | 130-136 | 7 | |
| α-helix | 139-141 | 3 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-159 | 5 | |
| α-helix | 167-172 | 6 | |
| β-strand | 180-187 | 8 | 3 |
| β-strand | 190-197 | 8 | 3 |
| α-helix | 201-210 | 10 | |
| β-strand | 216-222 | 7 | 3 |
| α-helix | 223-227 | 5 | |
| β-strand | 229 | 1 | 4 |
| β-strand | 237 | 1 | 4 |
| α-helix | 238-250 | 13 | |
| β-strand | 259-265 | 7 | 3 |
| α-helix | 267-274 | 8 | |
| α-helix | 279-281 | 3 | |
| α-helix | 295-304 | 10 | |
| α-helix | 308-311 | 4 | |
| β-strand | 316-319 | 4 | 3 |
| α-helix | 325-340 | 16 | |
Chain E: 13 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 279-281 | 3 | |
| α-helix | 290-295 | 6 | |
| α-helix | 300-304 | 5 | |
| α-helix | 307-319 | 13 | |
| α-helix | 324-337 | 14 | |
| α-helix | 340-342 | 3 | |
| α-helix | 343-350 | 8 | |
| α-helix | 351-355 | 5 | |
| α-helix | 367-376 | 10 | |
| α-helix | 386-396 | 11 | |
| α-helix | 397-401 | 5 | |
| α-helix | 402-404 | 3 | |
| α-helix | 408-415 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i)… | A, D | protein | 325 | Bos taurus, Rattus norvegicus | P04695 (AlphaFold model), P10824 (AlphaFold model) |
| Regulator of G-protein signaling 9 | B, E | protein | 147 | Bos taurus | O46469 (AlphaFold model) |
| Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma | C | protein | 42 | Bos taurus | P04972 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>1FQJ_1 Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 (chains A, D)
DARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMT
TLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLN
DSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERK
KWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLN
KKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDT
QNVKFVFDAVTDIIIKENLKDCGLF
Sequence of entity 2 (B, E), FASTA
>1FQJ_2 Regulator of G-protein signaling 9 (chains B, E)
QFWDLNAKLVDIPTKMRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDL
KYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYML
MKKDSYARYLKSPIYKEMLAKAIEPQG
Sequence of entity 3 (C), FASTA
>1FQJ_3 Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (chains C)
GVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 2 |
| ALF | Tetrafluoroaluminate ion | Al F4 | 2 |
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 2 |
Primary citation
Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A. Slep, K.C., Kercher, M.A., He, W. et al. Nature (2001) 409:1071-1077. DOI 10.1038/35059138 · PubMed
Other PDB entries of the same protein (UniProt P04695 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1TAD 1.7 Å, Gtpase mechanism of gproteins from the 1.7-Å crystal structure of transducin…
- 1TAG 1.8 Å, Structural determinants for activation of the alpha-subunit of a heterotrimeric G protein
- 1GOT 2.0 Å, Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
- 1TND 2.2 Å, The 2.2 Å crystal structure of transducin-alpha complexed with GTP gamma S
- 1FQK 2.3 Å, Crystal structure of the heterodimeric complex of the rgs domain of RGS9, and the GT/I1…
- 4J4Q 2.65 Å, Crystal structure of active conformation of GPCR opsin stabilized by octylglucoside
- 3PQR 2.85 Å, Crystal structure of Metarhodopsin II in complex with a C-terminal peptide derived from…
- 3V00 2.9 Å, Studies of a constitutively active G-alpha subunit provide insights into the mechanism…
- 4BEY 2.9 Å, Night blindness causing G90D rhodopsin in complex with GaCT2 peptide
- 2X72 3.0 Å, Crystal structure of the constitutively active E113Q,D2C,D282C rhodopsin mutant with…
- 3DQB 3.2 Å, Crystal structure of the active G-protein-coupled receptor opsin in complex with a…
- 7JSN 3.2 Å, Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6
Browse structure collections
About this viewer
MolViewer shows 1FQJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.