1FRG: IGG2A 26/9 FAB

Crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody FAB 26(SLASH)9: fine-tuning antibody specificity. Determined by X-ray diffraction at 2.8 Å resolution. Released 31 May 1994.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,427
Mol. weight: 48.69 kDa
Released: 31 May 1994

Explore 1FRG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FRG contains 11 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	220-224	5	7
β-strand	228-229	2	8
β-strand	234-242	9	7
α-helix	246-248	3
β-strand	251-256	6	9
β-strand	262-268	7	9
β-strand	275-277	3	9
β-strand	285-290	6	7
β-strand	295-301	7	7
α-helix	305-307	3
β-strand	309-315	7	9
β-strand	326-327	2	9
β-strand	331-333	3	9
β-strand	334-335	2	8
β-strand	344-348	5	10
α-helix	354-356	3
β-strand	359-369	11	10
β-strand	375-378	4	11
α-helix	379-381	3
β-strand	383	1	11
β-strand	387-395	9	10
β-strand	398-408	11	10
β-strand	418-423	6	11
α-helix	424-426	3
β-strand	428-433	6	11

Chain L: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30-31	2	3
β-strand	36-37	2	3
β-strand	39-44	6	2
α-helix	49	1
β-strand	50-55	6	2
β-strand	59-60	2	2
α-helix	61	1
β-strand	68-73	6	1
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	91-96	6	2
α-helix	102	1
β-strand	104	1	2
β-strand	108-112	5	2
β-strand	117	1	4
β-strand	120-124	5	5
α-helix	128-132	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	150-156	7	6
β-strand	159-161	3	6
β-strand	165-169	5	5
β-strand	179-188	10	5
α-helix	189-192	4
β-strand	198-204	7	6
β-strand	211-215	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG2A 26/9 FAB (light chain)	L	protein	217	Mus musculus	P01837 (AlphaFold model)
IGG2A 26/9 FAB (heavy chain)	H	protein	220	Mus musculus	P01864 (AlphaFold model)
Influenza hemagglutinin HA1 (strain X47) (residues 101 - 108)	P	protein	10		P03438

Sequence of entity 1 (L), FASTA

>1FRG_1 IGG2A 26/9 FAB (LIGHT CHAIN) (chains L)
DIVMTQSPSSLTVTAGEKVTMSCKSSQSLFNSGKRKNFLTWYHQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTITSVQAEDLAIYYCQNDYSHPLTFGAGTKLELKRADAAPT
VSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYS
MSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (H), FASTA

>1FRG_2 IGG2A 26/9 FAB (HEAVY CHAIN) (chains H)
EVLLVESGGDLVKPGGFLKLSCAASGFTFSSFGMSWVRHTPDKRLEWVATISNGGGYTYY
QDSVKGRFTISRDNAKNTLFLEMTSLKSEDAGLYYCARRERYDEKGFAYWGRGTLVTVSA
AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Sequence of entity 3 (P), FASTA

>1FRG_3 INFLUENZA HEMAGGLUTININ HA1 (STRAIN X47) (RESIDUES 101 - 108) (chains P)
XDVPDYASLX

Primary citation

Crystal structure of a peptide complex of anti-influenza peptide antibody Fab 26/9. Comparison of two different antibodies bound to the same peptide antigen. Churchill, M.E., Stura, E.A., Pinilla, C. et al. J Mol Biol (1994) 241:534-556. DOI 10.1006/jmbi.1994.1530 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1FRG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.