1FRT: Complex of rat neonatal fc receptor with fc

Crystal structure of the complex of rat neonatal fc receptor with fc. Determined by X-ray diffraction at 4.5 Å resolution. Released 14 Feb 1995.

Method: X-ray diffraction
Resolution: 4.5 Å
Organism: Rattus norvegicus
Chains: 3
Atoms: 4,756
Mol. weight: 67.61 kDa
Ligands: NAG
Released: 14 Feb 1995

Explore 1FRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FRT contains 17 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
β-strand	24-30	7	1
β-strand	33-39	7	1
β-strand	46-47	2	1
α-helix	49-53	5
α-helix	60-85	26
β-strand	91-100	10	1
β-strand	106-114	9	1
β-strand	117-123	7	1
β-strand	128-131	4	1
α-helix	134-144	11
α-helix	148-155	8
α-helix	156-160	5
α-helix	161-171	11
α-helix	173-176	4
β-strand	180	1	2
α-helix	181-182	2
β-strand	183-190	8	3
β-strand	195-205	11	3
β-strand	206	1	2
β-strand	211-216	6	4
β-strand	219-220	2	4
β-strand	225-230	6	3
β-strand	236-245	10	3
α-helix	249-251	3
β-strand	252-257	6	4
β-strand	265-267	3	4

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
β-strand	6-11	6	6
α-helix	14-15	2
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
β-strand	50-51	2	6
β-strand	55-56	2	6
β-strand	62-70	9	6
β-strand	78-83	6	7
β-strand	91-94	4	7

Chain C: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	240-243	4	8
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-265	8	8
β-strand	275-279	5	9
β-strand	282-283	2	9
β-strand	292-295	4	8
β-strand	300-307	8	8
α-helix	310-314	5
β-strand	319-323	5	9
β-strand	332-336	5	9
β-strand	344	1	10
β-strand	347-351	5	11
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	11
β-strand	373	1	10
β-strand	377-383	7	12
β-strand	386-387	2	12
β-strand	391-393	3	11
α-helix	394-396	3
β-strand	397-398	2	11
β-strand	404-413	10	11
α-helix	414-418	5
β-strand	423-429	7	12
β-strand	437-441	5	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neonatal fc receptor	A	protein	269	Rattus norvegicus	P13599 (AlphaFold model)
Beta 2-microglobulin	B	protein	99	Rattus norvegicus	P07151 (AlphaFold model)
IgG fc	C	protein	205	Rattus norvegicus

Sequence of entity 1 (A), FASTA

>1FRT_1 NEONATAL FC RECEPTOR (chains A)
AEPRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQEADPCGAWIWENQVSWY
WEKETTDLKSKEQLFLEAIRTLENQINGTFTLQGLLGCELAPDNSSLPTAVFALNGEEFM
RFNPRTGNWSGEWPETDIVGNLWMKQPEAARKESEFLLTSCPERLLGHLERGRQNLEWKE
PPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWS
LLEVKRGDEHHYQCQVEHEGLAQPLTVDL

Sequence of entity 2 (B), FASTA

>1FRT_2 BETA 2-MICROGLOBULIN (chains B)
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDW
SFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Sequence of entity 3 (C), FASTA

>1FRT_3 IGG FC (chains C)
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNS
TYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Crystal structure of the complex of rat neonatal Fc receptor with Fc. Burmeister, W.P., Huber, A.H., Bjorkman, P.J. Nature (1994) 372:379-383. DOI 10.1038/372379a0 · PubMed

Other PDB entries of the same protein (UniProt P13599 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FRU 2.2 Å, Neonatal fc receptor, PH 6.5
1I1A 2.8 Å, Crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

Browse structure collections

About this viewer

MolViewer shows 1FRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.