3FRU: Neonatal fc receptor, PH 6.5

Neonatal fc receptor, PH 6.5. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Jun 1998.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Rattus norvegicus
Chains: 6
Atoms: 9,717
Mol. weight: 129.31 kDa
Ligands: NAG
Released: 10 Jun 1998

Explore 3FRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FRU contains 33 α-helices and 87 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
β-strand	24-30	7	1
β-strand	33-39	7	1
β-strand	46-47	2	1
α-helix	49-53	5
α-helix	60-85	26
β-strand	91-100	10	1
β-strand	106-114	9	1
β-strand	117-123	7	1
β-strand	128-130	3	1
α-helix	134-143	10
α-helix	147-155	9
α-helix	156-160	5
α-helix	161-171	11
α-helix	173-176	4
β-strand	180	1	2
α-helix	181-182	2
β-strand	183-190	8	3
β-strand	195-205	11	3
β-strand	206	1	2
β-strand	211-216	6	4
β-strand	219-220	2	4
β-strand	225-230	6	3
β-strand	236-245	10	3
α-helix	249-251	3
β-strand	252-257	6	4
β-strand	265-267	3	4

Chains B, D and F: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
α-helix	46	1
β-strand	50-51	2	6
β-strand	55-56	2	6
β-strand	62-70	9	6
β-strand	78-83	6	7
β-strand	91-94	4	7

Chain C: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	8
β-strand	24-30	7	8
β-strand	33-39	7	8
β-strand	46-47	2	8
α-helix	49-53	5
α-helix	60-85	26
β-strand	91-100	10	8
β-strand	106-114	9	8
β-strand	117-123	7	8
β-strand	128-130	3	8
α-helix	134-143	10
α-helix	148-155	8
α-helix	156-160	5
α-helix	161-171	11
α-helix	173-177	5
β-strand	180	1	9
α-helix	181-182	2
β-strand	183-190	8	10
β-strand	195-205	11	10
β-strand	206	1	9
β-strand	211-216	6	11
β-strand	219-220	2	11
β-strand	225-230	6	10
β-strand	236-245	10	10
α-helix	249-251	3
β-strand	252-257	6	11
β-strand	265-267	3	11

Chain E: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	15
β-strand	24-30	7	15
β-strand	33-39	7	15
β-strand	46-47	2	15
α-helix	49-52	4
α-helix	60-85	26
β-strand	91-100	10	15
β-strand	106-114	9	15
β-strand	117-123	7	15
β-strand	128-130	3	15
α-helix	134-143	10
α-helix	147-155	9
α-helix	156-160	5
α-helix	161-171	11
α-helix	173-176	4
β-strand	180	1	16
α-helix	181-182	2
β-strand	183-190	8	17
β-strand	195-205	11	17
β-strand	206	1	16
β-strand	211-216	6	18
β-strand	219-220	2	18
β-strand	225-230	6	17
β-strand	236-245	10	17
α-helix	249-251	3
β-strand	252-257	6	18
β-strand	265-267	3	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neonatal fc receptor	A, C, E	protein	269	Rattus norvegicus	P13599 (AlphaFold model)
Beta-2-microglobulin	B, D, F	protein	99	Rattus norvegicus	P07151 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>3FRU_1 NEONATAL FC RECEPTOR (chains A, C, E)
AEPRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQEADPCGAWIWENQVSWY
WEKETTDLKSKEQLFLEAIRTLENQINGTFTLQGLLGCELAPDNSSLPTAVFALNGEEFM
RFNPRTGNWSGEWPETDIVGNLWMKQPEAARKESEFLLTSCPERLLGHLERGRQNLEWKE
PPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWS
LLEVKRGDEHHYQCQVEHEGLAQPLTVDL

Sequence of entity 2 (B, D, F), FASTA

>3FRU_2 BETA-2-MICROGLOBULIN (chains B, D, F)
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDW
SFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (BME, SO4) are not listed.

Primary citation

Structural basis of pH-dependent antibody binding by the neonatal Fc receptor. Vaughn, D.E., Bjorkman, P.J. Structure (1998) 6:63-73. DOI 10.1016/S0969-2126(98)00008-2 · PubMed

Other PDB entries of the same protein (UniProt P13599 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1I1A 2.8 Å, Crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
1FRT 4.5 Å, Crystal structure of the complex of rat neonatal fc receptor with fc

Browse structure collections

About this viewer

MolViewer shows 3FRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.