1FTS: Ftsy

Name: PDB 1FTS: Signal recognition particle receptor from E. Coli
Published: 1998-05-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: signal recognition particle receptor

Signal recognition particle receptor from E. Coli. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 May 1998.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Escherichia coli
Chains: 1
Atoms: 2,261
Mol. weight: 32.18 kDa
Released: 20 May 1998

Explore 1FTS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FTS contains 17 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	206-208	3
α-helix	212-218	7
β-strand	222	1	1
α-helix	225-237	13
α-helix	242-257	16
β-strand	263	1	1
α-helix	264-266	3
α-helix	267-280	14
β-strand	294-299	6	2
α-helix	306-318	13
β-strand	324-327	4	2
α-helix	334-346	13
β-strand	351-352	2	2
α-helix	360-373	14
β-strand	378-382	5	2
α-helix	387-389	3
α-helix	390-404	15
β-strand	414-420	7	2
α-helix	421-423	3
α-helix	425-437	13
β-strand	442-446	5	2
α-helix	456-464	9
β-strand	468-472	5	2
α-helix	477-479	3
β-strand	480-482	3	2
α-helix	483	1
α-helix	485-493	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ftsy	A	protein	295	Escherichia coli	P10121 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FTS_1 FTSY (chains A)
RSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQ
LRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQ
GKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLI
ADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGL
TGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR

Primary citation

Crystal structure of the NG domain from the signal-recognition particle receptor FtsY. Montoya, G., Svensson, C., Luirink, J. et al. Nature (1997) 385:365-368. DOI 10.1038/385365a0 · PubMed

Other PDB entries of the same protein (UniProt P10121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N9B 1.22 Å, FtsY-NG ultra high-resolution
6N5J 1.37 Å, FtsY-NG high-resolution
6CQP 1.45 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6N5I 1.5 Å, FtsY-NG high-resolution
6NC1 1.6 Å, FtsY-NG high-resolution
2YHS 1.6 Å, Structure of the E. coli SRP receptor FtsY
6NC4 1.6 Å, FtsY-NG high-resolution
5NIY 1.7 Å, Signal recognition particle-docking protein FtsY
6CS8 1.75 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6CVD 1.78 Å, High resolution crystal structure of FtsY-NG domain of E. coli bound to fragment 1
6DLX 1.85 Å, FtsY-NG domain bound to fragment 3.
6N6N 1.88 Å, FtsY-NG high-resolution

Browse structure collections

About this viewer

MolViewer shows 1FTS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.