NMR structure of the N-SH2 domain of the P85 subunit of PI3-kinase. Determined by solution NMR. Released 21 Feb 2001.
Explore 1FU6 in 3D Show helices and sheets RCSB PDB PDBe
1FU6 contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-26 | 6 | |
| β-strand | 38 | 1 | 1 |
| β-strand | 49 | 1 | 1 |
| β-strand | 51-54 | 4 | 2 |
| β-strand | 57-60 | 4 | 2 |
| α-helix | 83-89 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase regulatory alpha subunit | A | protein | 111 | Rattus norvegicus | Q63787 (AlphaFold model) |
>1FU6_1 PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT (chains A) GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKS IKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY
NMR structure of the N-SH2 of the p85 subunit of phosphoinositide 3-kinase complexed to a doubly phosphorylated peptide reveals a second phosphotyrosine binding site. Weber, T., Schaffhausen, B., Liu, Y. et al. Biochemistry (2000) 39:15860-15869. DOI 10.1021/bi001474d · PubMed
Other PDB entries of the same protein (UniProt Q63787 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.