1FW4: Calmodulin

Crystal structure of E. Coli fragment TR2C from calmodulin to 1.7 a resolution. Determined by X-ray diffraction at 1.7 Å resolution. Released 2 May 2001.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Bos taurus
Chains: 1
Atoms: 575
Mol. weight: 8.24 kDa
Ligands: CA
Released: 2 May 2001

Explore 1FW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FW4 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	83-92	10
β-strand	99-100	2	1
α-helix	102-111	10
α-helix	118-126	9
β-strand	136-137	2	1
α-helix	138-144	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	71	Bos taurus	P62157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FW4_1 CALMODULIN (chains A)
DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN
YEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structure of Escherichia coli fragment TR2C from calmodulin to 1.7 A resolution. Olsson, L.L., Sjolin, L. Acta Crystallogr D Biol Crystallogr (2001) 57:664-669. DOI 10.1107/S090744490100347X · PubMed

Other PDB entries of the same protein (UniProt P62157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IF7 1.6 Å, Structure of Calmodulin complexed with its first endogenous inhibitor,…
1PRW 1.7 Å, Crystal structure of bovine brain Ca++ calmodulin in a compact form
1CDM 2.0 Å, Modulation of calmodulin plasticity in molecular recognition on the basis of X-ray…
1CM1 2.0 Å, Motions of calmodulin-single-conformer refinement
1CM4 2.0 Å, Motions of calmodulin-four-conformer refinement
1LIN 2.0 Å, Calmodulin complexed with trifluoperazine (1:4 complex)
1XA5 2.12 Å, Structure of Calmodulin in complex with KAR-2, a bis-indol alkaloid
2F2O 2.17 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…
1QIW 2.3 Å, Calmodulin complexed with N-(3,3,-diphenylpropyl)-N'-[1-R-(3,4-bis-butoxyphenyl)-ethyl]-p…
2FOT 2.45 Å, Crystal structure of the complex between calmodulin and alphaII-spectrin
2F2P 2.6 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…
1QIV 2.64 Å, Calmodulin complexed with N-(3,3,-diphenylpropyl)-N'-[1-R-(3,4-bis-butoxyphenyl)-ethyl]-p…

Browse structure collections

About this viewer

MolViewer shows 1FW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.