1G3F: Inhibitor of apoptosis protein 3

Name: PDB 1G3F: NMR structure of a 9 residue peptide from smac/diablo complexed to the BIR3 domain of xiap
Published: 2001-01-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

NMR structure of a 9 residue peptide from smac/diablo complexed to the BIR3 domain of xiap. Determined by solution NMR. Released 10 Jan 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,012
Mol. weight: 14.43 kDa
Ligands: ZN
Released: 10 Jan 2001

Explore 1G3F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G3F contains 5 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	244-246	3
α-helix	265-272	8
α-helix	281-287	7
β-strand	289-291	3	1
β-strand	298-300	3	1
β-strand	306-308	3	1
α-helix	316-323	8
α-helix	328-342	15

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	902-903	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inhibitor of apoptosis protein 3	A	protein	117	Homo sapiens	P98170 (AlphaFold model)
Smac	B	protein	9		Q9NR28 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1G3F_1 INHIBITOR OF APOPTOSIS PROTEIN 3 (chains A)
MSDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVK
CFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT

Sequence of entity 2 (B), FASTA

>1G3F_2 SMAC (chains B)
AVPIAQKSE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structural basis for binding of Smac/DIABLO to the XIAP BIR3 domain. Liu, Z., Sun, C., Olejniczak, E.T. et al. Nature (2000) 408:1004-1008. DOI 10.1038/35050006 · PubMed

Other PDB entries of the same protein (UniProt P98170 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J44 1.3 Å, Crystal structure of XIAP-BIR2 domain with AIAV bound
8W59 1.34 Å, Crystal structure of the RING domain of human XIAP treated with arsenic trioxide
4J47 1.35 Å, Crystal structure of XIAP-BIR2 domain with SVPI bound
4J46 1.42 Å, Crystal structure of XIAP-BIR2 domain with AVPI bound
4J3Y 1.45 Å, Crystal structure of XIAP-BIR2 domain
4J45 1.48 Å, Crystal structure of XIAP-BIR2 domain with ATAA bound
5O6T 1.57 Å, BIRC4 RING in complex with dimeric ubiquitin variant
4KJU 1.6 Å, Crystal structure of XIAP-Bir2 with a bound benzodiazepinone inhibitor.
8W5A 1.65 Å, Crystal structure of the RING domain of human XIAP
4KJV 1.7 Å, Crystal structure of XIAP-Bir2 with a bound spirocyclic benzoxazepinone inhibitor.
3UW5 1.71 Å, Crystal structure of the BIR domain of MLIAP bound to GDC0152
8GH7 1.75 Å, 142D6 bound to BIR3-XIAP

Browse structure collections

About this viewer

MolViewer shows 1G3F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.