Pse-4 carbenicillinase, wild type. Determined by X-ray diffraction at 1.95 Å resolution. Released 21 Feb 2001.
Explore 1G68 in 3D Show helices and sheets RCSB PDB PDBe
1G68 contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-39 | 13 | |
| β-strand | 43-50 | 8 | 1 |
| β-strand | 55-60 | 5 | 1 |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 69-72 | 4 | |
| α-helix | 73-85 | 13 | |
| β-strand | 94-96 | 3 | 3 |
| α-helix | 99-101 | 3 | |
| α-helix | 109-111 | 3 | |
| β-strand | 116-118 | 3 | 3 |
| α-helix | 119-129 | 11 | |
| α-helix | 132-141 | 10 | |
| α-helix | 144-154 | 11 | |
| α-helix | 168-170 | 3 | |
| β-strand | 180-181 | 2 | 2 |
| α-helix | 183-195 | 13 | |
| α-helix | 201-212 | 12 | |
| α-helix | 221-224 | 4 | |
| α-helix | 225-226 | 2 | |
| β-strand | 230-237 | 8 | 1 |
| α-helix | 240-242 | 3 | |
| β-strand | 244-252 | 9 | 1 |
| β-strand | 256-266 | 11 | 1 |
| α-helix | 272-291 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-lactamase pse-4 | A | protein | 271 | Pseudomonas aeruginosa | P16897 (AlphaFold model) |
>1G68_1 BETA-LACTAMASE PSE-4 (chains A) SSSKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLY DAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAV GGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEM NQKKLESWMVNNQVTGNLLRSVLPAGWNIADRSGAGGFGARSITAVVWSEHQAPIIVSIY LAQTQASMEERNDAIVKIGHSIFDVYTSQSR
Insights into the molecular basis for the carbenicillinase activity of PSE-4 beta-lactamase from crystallographic and kinetic studies. Lim, D., Sanschagrin, F., Passmore, L. et al. Biochemistry (2001) 40:395-402. DOI 10.1021/bi001653v · PubMed
Other PDB entries of the same protein (UniProt P16897 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1G68 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.