1GAQ: Ferredoxin-NADP+ reductase

Crystal structure of the complex between ferredoxin and ferredoxin-NADP+ reductase. Determined by X-ray diffraction at 2.59 Å resolution. Released 7 Feb 2001.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: Zea mays
Chains: 3
Atoms: 5,685
Mol. weight: 82.99 kDa
Ligands: FAD, FES
Released: 7 Feb 2001

Explore 1GAQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GAQ contains 27 α-helices and 52 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
β-strand	32	1	2
β-strand	38-41	4	3
β-strand	42-47	6	4
β-strand	57-63	7	4
β-strand	75-79	5	3
β-strand	83	1	5
β-strand	89	1	5
α-helix	90-92	3
β-strand	93-96	4	3
β-strand	97	1	4
β-strand	110-116	7	4
α-helix	117-118	2
β-strand	119-121	3	6
α-helix	126	1
β-strand	127-129	3	6
α-helix	131-137	7
β-strand	144-151	8	3
α-helix	156-157	2
β-strand	158	1	1
β-strand	164-170	7	7
α-helix	171-174	4
α-helix	175-184	10
β-strand	189	1	8
β-strand	192	1	8
β-strand	197-204	8	7
α-helix	207-209	3
α-helix	213-222	10
β-strand	227-233	7	7
β-strand	238	1	9
β-strand	244	1	9
α-helix	247-252	6
α-helix	255-259	5
β-strand	267-273	7	7
α-helix	277-289	13
α-helix	296-303	8
α-helix	304-306	3
β-strand	309-313	5	7

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	10
β-strand	14	1	10
α-helix	24-28	5
β-strand	49-50	2	11
β-strand	56-57	2	12
α-helix	68-71	4
β-strand	73	1	11
β-strand	80-81	2	12
β-strand	85-87	3	10
β-strand	88-89	2	11

Chain C: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	13
β-strand	32	1	14
β-strand	38-41	4	15
β-strand	42-47	6	16
β-strand	57-63	7	16
β-strand	75-78	4	15
α-helix	90-92	3
β-strand	93-96	4	15
β-strand	97	1	16
β-strand	110-116	7	16
β-strand	119-121	3	17
β-strand	127-129	3	17
α-helix	131-136	6
β-strand	144-151	8	15
α-helix	156-157	2
β-strand	158	1	13
β-strand	164-170	7	18
α-helix	171-174	4
α-helix	175-185	11
β-strand	197-204	8	18
α-helix	207-209	3
α-helix	213-222	10
β-strand	227-233	7	18
β-strand	238	1	19
β-strand	244	1	19
α-helix	247-252	6
α-helix	255-261	7
β-strand	267-273	7	18
α-helix	277-291	15
α-helix	296-304	9
β-strand	309-313	5	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferredoxin-NADP+ reductase	A, C	protein	314	Zea mays	Q9SLP6 (AlphaFold model)
Ferredoxin I	B	protein	98	Zea mays	P27787 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1GAQ_1 FERREDOXIN-NADP+ REDUCTASE (chains A, C)
IRAQASAVEAPATAKAKKESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHM
VFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIY
TNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSF
LWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNA
AGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYK
KQLKRGDQWNVEVY

Sequence of entity 2 (B), FASTA

>1GAQ_2 FERREDOXIN I (chains B)
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSD
QSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA

Ligands and cofactors

ID	Name	Formula	Copies
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	2
FES	FE2/S2 (inorganic) cluster	Fe2 S2	1

Primary citation

Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase. Kurisu, G., Kusunoki, M., Katoh, E. et al. Nat Struct Biol (2001) 8:117-121. DOI 10.1038/84097 · PubMed

Other PDB entries of the same protein (UniProt Q9SLP6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GAW 2.2 Å, Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf
3W5U 2.7 Å, Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase
3W5V 3.81 Å, Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase

Browse more

1GAQ is part of these collections:

Photosynthesis

About this viewer

MolViewer shows 1GAQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.