3W5V: Ferredoxin

Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase. Determined by X-ray diffraction at 3.81 Å resolution. Released 19 Jun 2013.

Method: X-ray diffraction
Resolution: 3.81 Å
Organism: Zea mays
Chains: 4
Atoms: 6,290
Mol. weight: 93.69 kDa
Ligands: FES, FAD
Released: 19 Jun 2013

Explore 3W5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3W5V contains 32 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
β-strand	32	1	2
α-helix	37	1
β-strand	38-42	5	3
β-strand	46-47	2	3
β-strand	57-63	7	3
β-strand	75-79	5	3
β-strand	83	1	4
α-helix	88	1
β-strand	89	1	4
α-helix	90-92	3
β-strand	93-97	5	3
β-strand	110-116	7	3
β-strand	119-121	3	5
β-strand	127-129	3	5
α-helix	131-137	7
β-strand	144-151	8	3
α-helix	156-157	2
β-strand	158	1	1
β-strand	164-170	7	6
α-helix	175-181	7
α-helix	182-186	5
β-strand	197-204	8	6
α-helix	213-222	10
β-strand	227-233	7	6
β-strand	238	1	7
β-strand	244	1	7
α-helix	247-252	6
α-helix	255-261	7
β-strand	267-273	7	6
α-helix	277-289	13
α-helix	296-305	10
β-strand	309-313	5	6

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	8
β-strand	12-19	8	8
α-helix	24-30	7
β-strand	48-53	6	8
β-strand	56-57	2	9
β-strand	59	1	10
β-strand	61	1	10
α-helix	66-69	4
β-strand	73-75	3	8
α-helix	76-78	3
β-strand	80-81	2	9
β-strand	85-88	4	8
α-helix	92-95	4

Chain C: 12 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	11
β-strand	32	1	12
β-strand	38-42	5	13
β-strand	46-47	2	13
β-strand	57-63	7	13
β-strand	75-79	5	13
β-strand	83	1	14
α-helix	88	1
β-strand	89	1	14
α-helix	90-92	3
β-strand	93-97	5	13
β-strand	110-116	7	13
β-strand	119-121	3	15
β-strand	127-129	3	15
α-helix	131-137	7
β-strand	144-151	8	13
α-helix	156-157	2
β-strand	158	1	11
β-strand	164-170	7	16
α-helix	171-173	3
α-helix	175-181	7
α-helix	182-186	5
β-strand	197-204	8	16
α-helix	213-222	10
β-strand	227-233	7	16
β-strand	238	1	17
β-strand	244	1	17
α-helix	247-252	6
α-helix	255-261	7
β-strand	267-273	7	16
α-helix	277-289	13
α-helix	296-305	10
β-strand	309-313	5	16

Chain D: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	18
β-strand	12-19	8	18
α-helix	24-30	7
β-strand	48-53	6	18
β-strand	56-57	2	19
β-strand	59	1	20
β-strand	61	1	20
α-helix	66-70	5
β-strand	73-75	3	18
α-helix	76-78	3
β-strand	80-81	2	19
β-strand	85-89	5	18
α-helix	92-95	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferredoxin	A, C	protein	314	Zea mays	Q9SLP6 (AlphaFold model)
Ferredoxin-1, chloroplastic	B, D	protein	98	Zea mays	P27787 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3W5V_1 Ferredoxin (chains A, C)
IRAQASAVEAPATAKAKKCSKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHM
VFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIY
TNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSF
LWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNA
AGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYK
KQLKRGDQWNVEVY

Sequence of entity 2 (B, D), FASTA

>3W5V_2 Ferredoxin-1, chloroplastic (chains B, D)
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSD
QSYLDDGQICDGWVLTCHAYPTSDVVIETHKEEELTGA

Ligands and cofactors

ID	Name	Formula	Copies
FES	FE2/S2 (inorganic) cluster	Fe2 S2	2
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	2

Primary citation

Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase. Kimata-Ariga, Y., Kubota-Kawai, H., Lee, Y.-H. et al. Biochem Biophys Res Commun (2013) 434:867-872. DOI 10.1016/j.bbrc.2013.04.033 · PubMed

Other PDB entries of the same protein (UniProt Q9SLP6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GAW 2.2 Å, Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf
1GAQ 2.59 Å, Crystal structure of the complex between ferredoxin and ferredoxin-NADP+ reductase
3W5U 2.7 Å, Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase

Browse structure collections

About this viewer

MolViewer shows 3W5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.